close

SimulationCraft 603-19

for World of Warcraft 6.0.3 Live (build level 19243)

Table of Contents

Raid Summary

 

DPS Chart
Ciaran

Ciaran : 20003 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
20002.6 20002.6 8.9 / 0.045% 2804.3 / 14.0% 36.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
550.2 550.2 Mana 0.25% 36.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ciaran/advanced
Talents
  • 15: Feline Swiftness
  • 30: Ysera's Gift
  • 45: Typhoon
  • 60: Force of Nature
  • 75: Incapacitating Roar
  • 90: Nature's Vigil
  • 100: Balance of Power
  • Talent Calculator
Glyphs
  • Glyph of Guided Stars
  • Glyph of Rebirth
  • Glyph of Stars
  • Glyph of the Chameleon
  • Glyph of the Stag
Professions
  • leatherworking: 2
  • skinning: 146

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Ciaran+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x120&chd=t:29822|15156|11374&chds=0,59643&chco=8AD0B1,69CCF0,ABD473&chm=t++29822++starsurge,8AD0B1,0,0,15|t++15156++starfire,69CCF0,1,0,15|t++11374++wrath,ABD473,2,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ciaran+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:34,20,20,13,12,2,1&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,69CCF0,ABD473,C79C6E,ABD473&chl=starfire|wrath|starsurge|moonfire|sunfire|shattered_bleed|treant: wrath&
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Ciaran+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:abgimrtyz36468567301xzvusnnjiggfeefdddccbabaaabccaZaaaYaabbbccbccbaaabbbabbaZYZYYYZYYZaaaaZZaZZabcbcccbccbaZaabbabbaZZZZZZZZZabccbabbbbcdddddddddcbbbbccbccbaZaaZZZZZaabbaZabaaacddefghijkklnoppppppponmljjhhgfedccbaaaaZZZYZaabaaaabaabbbbbbbccbaaaaaaaaaaZZaaZZaZZabbcbbccccccdcccdcddcbbaabaaaaaZZZZZZZZZZaabaabbbbbbcbbbbbbbaaaZaaZZZZZYYZZYZZYYZaabaaabaaabbaabaaaaaYZYXWUTRQONML&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.505662,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=20003|max=39557&chxp=1,1,51,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Ciaran+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,6,11,19,27,43,77,107,148,251,330,413,545,685,822,964,1071,1164,1231,1509,1477,1397,1354,1342,1277,1244,1108,1069,897,796,750,576,462,444,325,249,206,155,117,100,73,49,30,24,16,13,9,7,5,2&chds=0,1509&chbh=5&chxt=x&chxl=0:|min=17680|avg=20003|max=22843&chxp=0,1,45,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ciaran+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:44.1,35.1,13.2,3.6,3.4,0.3&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,ABD473,69CCF0,ffffff&chl=starfire 132.7s|wrath 105.7s|starsurge 39.8s|sunfire 10.9s|moonfire 10.4s|waiting 0.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ciaran 20003
moonfire 2496 12.5% 9.0 34.97sec 83249 72257 Direct 9.0 4686 9014 5379 16.0% 1.6 1574 3112 15.7%  
Periodic 174.9 3236 6544 3770 16.1% 34.2 975 1974 16.2% 99.1%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.01 9.01 174.93 174.93 1.1522 1.7039 749664.87 749664.87 0.00 2430.51 72256.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.25 15.73% 3112.07 2018 7468 683.07 0 7468 769 769 0.00
multistrike 1.32 84.27% 1574.13 1007 3734 1161.65 0 3734 2083 2083 0.00
hit 7.56 84.00% 4686.08 0 12447 4645.39 2427 7657 35446 35446 0.00
crit 1.44 16.00% 9014.31 0 24894 7068.35 0 24894 12988 12988 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.5 16.21% 1974.47 1190 5933 1970.24 0 5933 10938 10938 0.00
multistrike 28.6 83.79% 975.23 595 2966 977.22 701 1378 27933 27933 0.00
hit 146.7 83.86% 3236.05 2 9888 3242.31 2982 3582 474720 474720 0.00
crit 28.2 16.14% 6544.16 3 19777 6558.29 4776 9189 184788 184788 0.00
 
DPS Timeline Chart
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that burns the enemy for {$164812s1=1 + 40.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.292500
  • base_td:0.00
  • dot_duration:40.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 384 1.9% 17.4 17.68sec 6649 0 Direct 17.4 1622 3257 1884 16.0% 3.4 487 978 16.1%  
Periodic 97.1 786 0 786 0.0% 18.9 239 0 0.0% 32.3%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.37 17.37 97.06 97.06 0.0000 1.0000 115469.83 115469.83 0.00 1189.72 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.55 16.10% 978.37 955 1146 408.05 0 1146 534 534 0.00
multistrike 2.84 83.90% 486.51 478 573 454.97 0 573 1383 1383 0.00
hit 14.58 83.97% 1622.03 1592 1910 1622.24 1592 1751 23652 23652 0.00
crit 2.78 16.03% 3256.55 3184 3821 3061.27 0 3821 9066 9066 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 18.9 100.00% 238.79 239 239 238.79 239 239 4522 4522 0.00
hit 97.1 100.00% 786.27 1 796 786.54 755 796 76312 76312 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
starfire 6715 33.5% 52.6 5.61sec 38202 15156 Direct 52.6 30824 62947 36084 16.4% 10.3 9251 18929 16.4%  

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.64 52.64 0.00 0.00 2.5206 0.0000 2011031.31 2011031.31 0.00 15156.20 15156.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.68 16.36% 18929.14 11648 28049 15432.71 0 28049 31882 31882 0.00
multistrike 8.61 83.64% 9250.62 5819 14024 9267.59 0 14024 79642 79642 0.00
hit 44.02 83.63% 30824.30 17276 46748 30889.76 26423 35058 1357000 1357000 0.00
crit 8.62 16.37% 62947.49 38799 93495 63110.18 0 93495 542507 542507 0.00
 
DPS Timeline Chart
 

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that causes {$s1=1 + 187.2%} Arcane damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.340000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
starsurge 3957 19.8% 31.1 9.86sec 38200 29822 Direct 30.9 30989 63208 36258 16.4% 6.0 9296 18931 16.4%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.08 30.94 0.00 0.00 1.2810 0.0000 1187228.25 1187228.25 0.00 29821.61 29821.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.99 16.36% 18930.64 14550 26968 11780.90 0 26968 18659 18659 0.00
multistrike 5.04 83.64% 9295.69 7273 13484 9234.49 0 13484 46833 46833 0.00
hit 25.88 83.65% 30989.34 24244 44947 31033.98 28199 34510 801952 801952 0.00
crit 5.06 16.35% 63208.25 48489 89893 62970.39 0 89893 319784 319784 0.00
 
DPS Timeline Chart
 

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.down&eclipse_energy>20
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:
  • description:Instantly causes {$78674s1=2242} Spellstorm damage to the target, benefiting from your strongest current Eclipse bonus. Also grants Lunar or Solar Empowerment, based on current Balance Energy side, which increases the damage of your next $164547n Starfires or $164545n Wraths by {$164545s1=30}%. Max 3 charges. Charges shared with Starfall.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.925000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
sunfire 2316 11.6% 9.5 32.33sec 72980 64117 Direct 9.5 6808 13742 7900 15.7% 1.7 2268 4521 16.0%  
Periodic 168.3 2967 6015 3459 16.1% 32.9 891 1809 16.1% 96.1%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.54 9.54 168.29 168.29 1.1383 1.7188 696049.44 696049.44 0.00 2319.17 64116.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.27 16.04% 4521.13 2014 5061 1068.35 0 5061 1217 1217 0.00
multistrike 1.41 83.96% 2268.50 1007 2531 1735.22 0 2531 3197 3197 0.00
hit 8.04 84.25% 6808.04 0 8435 6789.24 3280 8435 54707 54707 0.00
crit 1.50 15.75% 13742.39 0 16871 11051.31 0 16871 20639 20639 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.3 16.13% 1808.76 1190 4021 1802.38 0 4021 9593 9593 0.00
multistrike 27.6 83.87% 891.40 595 2010 892.66 712 1183 24590 24590 0.00
hit 141.1 83.86% 2966.93 1193 6701 2970.77 2783 3213 418733 418733 0.00
crit 27.2 16.14% 6014.92 2387 13403 6024.49 4621 7992 163374 163374 0.00
 
DPS Timeline Chart
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1056.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<7|buff.solar_peak.up
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every {$t2=0} seconds.
  • description:A Solar spell that burns the enemy for {$164815s1=389} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.292500
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
wrath 3982 20.0% 60.4 4.35sec 19897 11374 Direct 60.1 16338 32714 18885 15.5% 11.8 4901 9823 15.5%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.39 60.10 0.00 0.00 1.7494 0.0000 1201658.58 1201658.58 0.00 11373.74 11373.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.82 15.50% 9822.67 6734 13536 8198.85 0 13536 17919 17919 0.00
multistrike 9.95 84.50% 4900.64 3367 6770 4902.44 0 5940 48750 48750 0.00
hit 50.76 84.45% 16338.36 11224 22785 16346.82 14624 18025 829264 829264 0.00
crit 9.35 15.55% 32714.13 22448 43881 32728.94 0 39599 305726 305726 0.00
 
DPS Timeline Chart
 

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:
  • description:A Solar spell that causes {$s1=1121} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.462500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - treant 210 / 152
wrath 210 0.8% 102.9 3.10sec 443 207 Direct 102.5 361 726 420 16.1% 20.1 108 218 16.2%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.95 102.51 0.00 0.00 2.1434 0.0000 45582.53 45582.53 0.00 206.57 206.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.25 16.21% 217.78 210 258 208.98 0 258 708 708 0.00
multistrike 16.81 83.79% 108.41 105 129 108.45 105 121 1822 1822 0.00
hit 85.99 83.89% 361.32 350 431 361.46 355 372 31072 31072 0.00
crit 16.51 16.11% 725.61 700 861 725.96 700 834 11981 11981 0.00
 
DPS Timeline Chart
 

Action details: wrath

Static Values
  • id:113769
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113769
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Causes {$s1=180} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Ciaran
celestial_alignment 2.0 181.85sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.68 83.63% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.33 16.37% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: celestial_alignment

Static Values
  • id:112071
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:eclipse_energy>40
Spelldata
  • id:112071
  • name:Celestial Alignment
  • school:physical
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
force_of_nature 16.9 19.57sec

Stats details: force_of_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.89 16.89 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.24 84.29% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.65 15.71% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: force_of_nature

Static Values
  • id:33831
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:trinket.stat.intellect.up|charges=3|target.time_to_die<21
Spelldata
  • id:33831
  • name:Force of Nature
  • school:nature
  • tooltip:
  • description:Summons a Treant which will immediately root your current target for {$113770d=30 seconds}. The Treant will cast Wrath at that target for {$113769s1=180} Nature damage every 2 sec. Lasts {$d=15 seconds}. Maximum 3 charges.
 
moonkin_form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.86 86.35% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.14 13.65% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2976.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 25.01% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
celestial_alignment 2.0 0.0 181.8sec 181.8sec 10.15% 18.44% 300.2(300.2)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • celestial_alignment_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
draenic_intellect_potion 2.0 0.0 186.4sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lunar_empowerment 18.5 1.2 16.4sec 15.9sec 66.90% 69.84% 1.2(1.4)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_lunar_empowerment
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lunar_empowerment_1:26.86%
  • lunar_empowerment_2:40.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Starfire is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Starfires within {$d=30 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
lunar_peak 7.1 0.0 42.5sec 42.5sec 9.67% 11.26% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_lunar_peak
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • lunar_peak_1:9.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171743
  • name:Lunar Peak
  • tooltip:Increases the damage of your next Moonfire by {$s1=100}%.
  • description:{$@spelldesc8921=A Lunar spell that burns the enemy for {$164812s1=1 + 40.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
nightmare_fire 2.8 0.0 125.9sec 125.9sec 18.05% 18.07% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
solar_empowerment 10.8 0.7 24.3sec 22.8sec 41.66% 46.10% 0.7(1.1)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • solar_empowerment_1:12.08%
  • solar_empowerment_2:13.52%
  • solar_empowerment_3:16.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Wraths within {$d=30 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
solar_peak 6.6 0.0 42.7sec 42.7sec 1.16% 5.61% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_solar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • solar_peak_1:1.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171744
  • name:Solar Peak
  • tooltip:Increases the damage of your next Sunfire by {$s1=100}%.
  • description:{$@spelldesc93402=A Solar spell that burns the enemy for {$164815s1=389} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
moonkin_form

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ciaran
moonfire Mana 8.0 8453.1 1056.0 938.7 88.7
starfire Mana 52.6 50536.3 960.0 960.0 39.8
starsurge Mana 31.1 29836.2 960.0 960.0 39.8
sunfire Mana 8.6 9077.1 1056.0 951.7 76.7
wrath Mana 60.4 67641.1 1120.0 1120.0 17.8
Resource Gains Type Count Total Average Overflow
yseras_gift Health 4.18 0.00 (0.00%) 0.00 39635.70 100.00%
energy_regen Energy 168.17 0.00 (0.00%) 0.00 3515.23 100.00%
external_healing Health 4.22 0.00 (0.00%) 0.00 37998.57 100.00%
mp5_regen Mana 168.17 165333.45 (100.00%) 983.13 539389.31 76.54%
leech Health 738.67 0.00 (0.00%) 0.00 39451.69 100.00%
Resource RPS-Gain RPS-Loss
Mana 549.46 550.16
Combat End Resource Mean Min Max
Mana 159795.28 158880.00 160000.00
Eclipse 9.24 -105.00 105.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 79.3%
treant-Mana Cap 79.3%
treant-Mana Cap 79.3%
treant-Mana Cap 79.3%
treant-Mana Cap 79.3%

Procs

Count Interval
Shooting Stars overflow (buff already up) 0.1 67.3sec
Shooting Stars 19.9 14.3sec
wrong_eclipse_wrath 0.0 40.0sec
wrong_eclipse_starfire 0.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Ciaran Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Ciaran Damage Per Second
Count 25000
Mean 20002.57
Minimum 17679.93
Maximum 22842.75
Spread ( max - min ) 5162.83
Range [ ( max - min ) / 2 * 100% ] 12.91%
Standard Deviation 718.5259
5th Percentile 18875.09
95th Percentile 21229.59
( 95th Percentile - 5th Percentile ) 2354.50
Mean Distribution
Standard Deviation 4.5444
95.00% Confidence Intervall ( 19993.66 - 20011.47 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4956
0.1 Scale Factor Error with Delta=300 4407
0.05 Scale Factor Error with Delta=300 17629
0.01 Scale Factor Error with Delta=300 440725
Distribution Chart
DPS(e)
Sample Data Ciaran Damage Per Second (Effective)
Count 25000
Mean 20002.57
Minimum 17679.93
Maximum 22842.75
Spread ( max - min ) 5162.83
Range [ ( max - min ) / 2 * 100% ] 12.91%
Damage
Sample Data Ciaran Damage
Count 25000
Mean 5961102.28
Minimum 4339988.95
Maximum 7974080.14
Spread ( max - min ) 3634091.20
Range [ ( max - min ) / 2 * 100% ] 30.48%
DTPS
Sample Data Ciaran Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ciaran Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ciaran Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ciaran Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ciaran Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ciaran Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data CiaranTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ciaran Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_surprise
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 moonkin_form
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=draenic_intellect,if=buff.celestial_alignment.up
8 0.00 blood_fury,if=buff.celestial_alignment.up
9 0.00 berserking,if=buff.celestial_alignment.up
A 0.00 arcane_torrent,if=buff.celestial_alignment.up
B 16.89 force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
C 0.00 call_action_list,name=single_target,if=active_enemies=1
D 0.00 call_action_list,name=aoe,if=active_enemies>1
actions.single_target
# count action,conditions
E 17.38 starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20
F 10.52 starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
G 3.18 starsurge,if=(charges=2&recharge_time<6)|charges=3
H 2.01 celestial_alignment,if=eclipse_energy>40
I 0.00 incarnation,if=eclipse_energy>0
J 8.60 sunfire,if=remains<7|buff.solar_peak.up
K 0.00 stellar_flare,if=remains<7
L 8.00 moonfire,if=buff.lunar_peak.up&remains<eclipse_change+20|remains<4|(buff.celestial_alignment.up&buff.celestial_alignment.remains<=2&remains<eclipse_change+20)
M 60.76 wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
N 53.06 starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

Sample Sequence

0135BGLNHJNENNENNENBNENGNNENMJMFMMBMFJMMMMNLNNBENNENMMMFMMBJMMMFMNLNNEBNNNEMMMFMMJBMFMMMNLNENNBENNEMMFMMJMFBMMMMNLNENH7NBELNNENNENNBMMFMMMFJMMMFNBENNLNNNMMBMMMFJMMMFMNNBBBENLNNNEMMMBMMM

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre moonkin_form Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:01.335 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 21.9/105: 21% eclipse bloodlust, lunar_empowerment(2), draenic_intellect_potion
0:02.362 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 38.1/105: 36% eclipse bloodlust, lunar_empowerment(2), draenic_intellect_potion
0:04.413 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, lunar_empowerment, draenic_intellect_potion
0:04.413 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:05.441 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:07.491 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, draenic_intellect_potion
0:08.519 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
0:10.571 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:12.621 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, draenic_intellect_potion
0:13.649 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
0:15.699 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:17.750 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, draenic_intellect_potion
0:18.778 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 67.1/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:20.829 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 83.3/105: 79% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:20.829 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 83.3/105: 79% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:22.881 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 99.2/105: 95% eclipse bloodlust, nightmare_fire
0:23.907 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse bloodlust, lunar_empowerment(2), lunar_peak, nightmare_fire
0:25.959 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 103.8/105: 99% eclipse bloodlust, lunar_empowerment, lunar_peak, nightmare_fire
0:26.984 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 99.9/105: 95% eclipse bloodlust, lunar_empowerment(2), lunar_peak, nightmare_fire
0:29.034 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 84.6/105: 81% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:31.086 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 60.6/105: 58% eclipse bloodlust, nightmare_fire
0:32.115 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 46.0/105: 44% eclipse bloodlust, lunar_empowerment(2), nightmare_fire
0:34.169 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 13.7/105: 13% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:35.538 sunfire Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lunar_empowerment, nightmare_fire
0:36.564 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lunar_empowerment, nightmare_fire
0:37.933 starsurge Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lunar_empowerment
0:38.961 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lunar_empowerment, solar_empowerment(3)
0:40.329 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lunar_empowerment, solar_empowerment(2)
0:41.699 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment
0:41.699 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment
0:43.478 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_peak
0:44.811 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_peak, solar_empowerment(3)
0:46.146 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(3)
0:47.922 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(2)
0:49.700 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment
0:51.481 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
0:53.260 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
0:55.926 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 15.2/105: 14% eclipse
0:57.261 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 36.5/105: 35% eclipse
0:59.928 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 73.4/105: 70% eclipse
1:02.594 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 97.6/105: 93% eclipse
1:02.594 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 97.6/105: 93% eclipse
1:03.929 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse lunar_empowerment(2), lunar_peak
1:06.594 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 101.7/105: 97% eclipse lunar_empowerment, lunar_peak
1:09.260 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 82.4/105: 78% eclipse
1:10.596 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 67.0/105: 64% eclipse lunar_empowerment(2)
1:13.262 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 28.3/105: 27% eclipse lunar_empowerment
1:15.040 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:16.818 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:18.597 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:19.931 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(3)
1:21.708 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(2)
1:23.487 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_peak, solar_empowerment
1:23.487 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_peak, solar_empowerment
1:24.822 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment
1:26.600 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:28.378 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:30.156 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:31.490 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(3)
1:33.267 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(2)
1:35.933 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 15.3/105: 15% eclipse solar_empowerment(2)
1:37.266 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 36.6/105: 35% eclipse solar_empowerment(2)
1:39.932 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 73.4/105: 70% eclipse solar_empowerment(2)
1:42.598 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 97.6/105: 93% eclipse solar_empowerment(2)
1:43.933 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2)
1:43.933 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2)
1:46.599 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 101.7/105: 97% eclipse lunar_empowerment, lunar_peak, solar_empowerment(2)
1:49.265 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 82.3/105: 78% eclipse solar_empowerment(2)
1:51.930 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 48.7/105: 46% eclipse solar_empowerment(2)
1:53.265 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 28.3/105: 27% eclipse lunar_empowerment(2), solar_empowerment(2)
1:55.043 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
1:56.821 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:58.601 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:59.934 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:01.712 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:03.491 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_peak, solar_empowerment
2:04.827 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:04.827 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:06.607 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:07.941 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:09.719 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:11.494 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:13.271 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), nightmare_fire
2:15.934 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 15.3/105: 15% eclipse lunar_empowerment, nightmare_fire
2:17.268 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 36.6/105: 35% eclipse lunar_empowerment, nightmare_fire
2:19.935 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 73.5/105: 70% eclipse nightmare_fire
2:21.266 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 87.4/105: 83% eclipse lunar_empowerment(2), nightmare_fire
2:23.932 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse lunar_empowerment, lunar_peak, nightmare_fire
2:26.597 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 101.7/105: 97% eclipse lunar_peak, nightmare_fire
2:26.597 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 101.7/105: 97% eclipse lunar_peak, nightmare_fire
2:27.932 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 94.1/105: 90% eclipse lunar_empowerment(2), lunar_peak, nightmare_fire
2:30.599 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.9/105: 64% eclipse lunar_empowerment, nightmare_fire
2:33.264 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 28.3/105: 27% eclipse nightmare_fire
2:34.599 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 6.6/105: 6% eclipse lunar_empowerment(2)
2:36.378 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:38.157 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:39.491 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:41.270 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:43.049 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_peak, solar_empowerment
2:44.382 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:46.160 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:47.494 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:47.494 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:49.273 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:51.051 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:52.830 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:54.608 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:57.274 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 36.7/105: 35% eclipse lunar_empowerment
2:58.610 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 56.4/105: 54% eclipse lunar_empowerment
3:01.276 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 87.5/105: 83% eclipse
3:02.610 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 97.7/105: 93% eclipse lunar_empowerment(2)
3:05.278 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse lunar_empowerment, lunar_peak
3:05.278 potion Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, lunar_empowerment, lunar_peak
3:05.278 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, lunar_empowerment, lunar_peak, draenic_intellect_potion
3:07.944 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, lunar_peak, draenic_intellect_potion
3:07.944 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, lunar_peak, draenic_intellect_potion
3:09.278 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, lunar_empowerment(2), lunar_peak, draenic_intellect_potion
3:10.612 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
3:13.276 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, lunar_empowerment, draenic_intellect_potion
3:15.943 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:17.277 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
3:19.942 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse celestial_alignment, lunar_empowerment, draenic_intellect_potion
3:22.608 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 96.3/105: 92% eclipse draenic_intellect_potion
3:23.941 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 85.5/105: 81% eclipse lunar_empowerment(2), draenic_intellect_potion
3:26.606 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 53.4/105: 51% eclipse lunar_empowerment, draenic_intellect_potion
3:29.271 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 12.0/105: 11% eclipse draenic_intellect_potion
3:29.271 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 12.0/105: 11% eclipse draenic_intellect_potion
3:31.049 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:32.826 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
3:34.161 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
3:35.940 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
3:37.720 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
3:39.499 starsurge Fluffy_Pillow 160000.0/160000: 100% mana solar_peak
3:40.832 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment(3)
3:42.167 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
3:43.944 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
3:45.725 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
3:47.504 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
3:48.837 starfire Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
3:51.503 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 24.6/105: 23% eclipse solar_empowerment(3)
3:51.503 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 24.6/105: 23% eclipse solar_empowerment(3)
3:52.838 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 45.3/105: 43% eclipse lunar_empowerment(2), solar_empowerment(3)
3:55.505 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 79.9/105: 76% eclipse lunar_empowerment, solar_empowerment(3)
3:58.169 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 100.7/105: 96% eclipse lunar_peak, solar_empowerment(3)
3:59.503 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.7/105: 100% eclipse solar_empowerment(3)
4:02.168 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 99.0/105: 94% eclipse solar_empowerment(3)
4:04.834 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 76.2/105: 73% eclipse solar_empowerment(3)
4:07.500 Waiting 0.800 sec 160000.0/160000: 100% mana | 40.2/105: 38% eclipse solar_empowerment(3)
4:08.300 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 27.7/105: 26% eclipse solar_empowerment(3)
4:10.080 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
4:11.857 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment, nightmare_fire
4:11.857 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment, nightmare_fire
4:13.635 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:15.414 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:17.192 starsurge Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:18.527 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment(3), nightmare_fire
4:19.862 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
4:21.642 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2), nightmare_fire
4:23.421 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment, nightmare_fire
4:25.200 starsurge Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:26.534 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
4:28.314 starfire Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2), nightmare_fire
4:30.981 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 16.1/105: 15% eclipse solar_empowerment(2), nightmare_fire
4:33.647 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 56.9/105: 54% eclipse solar_empowerment(2)
4:33.647 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 56.9/105: 54% eclipse solar_empowerment(2)
4:33.647 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 56.9/105: 54% eclipse solar_empowerment(2)
4:33.647 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 56.9/105: 54% eclipse solar_empowerment(2)
4:34.982 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 74.0/105: 71% eclipse lunar_empowerment(2), solar_empowerment(2)
4:37.648 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 97.9/105: 93% eclipse lunar_empowerment, solar_empowerment(2)
4:38.984 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.7/105: 99% eclipse lunar_empowerment, lunar_peak, solar_empowerment(2)
4:41.650 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 101.5/105: 97% eclipse lunar_peak, solar_empowerment(2)
4:44.317 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 81.8/105: 78% eclipse solar_empowerment(2)
4:46.981 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 47.9/105: 46% eclipse solar_empowerment(2)
4:48.317 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 27.4/105: 26% eclipse lunar_empowerment(2), solar_empowerment(2)
4:50.094 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
4:51.873 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
4:53.650 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
4:53.650 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
4:55.427 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
4:57.206 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 653 622 622
Agility 1352 1288 1288
Stamina 4018 3653 3653
Intellect 3841 3395 3286 (2192)
Spirit 782 782 782
Health 241080 219180 0
Mana 160000 160000 0
Eclipse 105 105 0
Spell Power 5279 4353 958
Crit 16.75% 11.75% 742
Haste 12.70% 7.33% 627
Multistrike 9.77% 4.77% 315
Damage / Heal Versatility 6.13% 3.13% 407
ManaReg per Second 2321 640 0
Mastery 38.98% 27.36% 725
Armor 2598 866 866

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Balance Druid) Mass Entanglement Typhoon
60 Soul of the Forest Incarnation: Chosen of Elune Force of Nature
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil
100 Euphoria Stellar Flare Balance of Power

Profile

druid="Ciaran"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ciaran/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/225/94028513-avatar.jpg"
level=100
race=night_elf
role=spell
position=back
professions=leatherworking=2/skinning=146
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!0022022
glyphs=guided_stars/rebirth/stars/chameleon/stag
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/stellar_flare

# Executed every time the actor is available.

actions=potion,name=draenic_intellect,if=buff.celestial_alignment.up
actions+=/blood_fury,if=buff.celestial_alignment.up
actions+=/berserking,if=buff.celestial_alignment.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up
actions+=/force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
actions+=/call_action_list,name=single_target,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.single_target=starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20
actions.single_target+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
actions.single_target+=/starsurge,if=(charges=2&recharge_time<6)|charges=3
actions.single_target+=/celestial_alignment,if=eclipse_energy>40
actions.single_target+=/incarnation,if=eclipse_energy>0
actions.single_target+=/sunfire,if=remains<7|buff.solar_peak.up
actions.single_target+=/stellar_flare,if=remains<7
actions.single_target+=/moonfire,if=buff.lunar_peak.up&remains<eclipse_change+20|remains<4|(buff.celestial_alignment.up&buff.celestial_alignment.remains<=2&remains<eclipse_change+20)
actions.single_target+=/wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.single_target+=/starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

actions.aoe=celestial_alignment,if=lunar_max<8|target.time_to_die<20
actions.aoe+=/incarnation,if=buff.celestial_alignment.up
actions.aoe+=/sunfire,cycle_targets=1,if=remains<8
actions.aoe+=/starfall,if=!buff.starfall.up&active_enemies>2
actions.aoe+=/starsurge,if=(charges=2&recharge_time<6)|charges=3
actions.aoe+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe+=/stellar_flare,cycle_targets=1,if=remains<7
actions.aoe+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20&active_enemies=2
actions.aoe+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40&active_enemies=2
actions.aoe+=/wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe+=/starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

head=crown_of_woe,id=118941
neck=demonbinder_cabochon,id=109955,bonus_id=524,enchant=40crit
shoulders=supple_shoulderguards,id=116176,bonus_id=48/525/536
back=brilliant_hexweave_cloak,id=114819,bonus_id=170/525/537,enchant=100crit
chest=witherleaf_chestguard,id=120088
wrists=bracers_of_determined_resolve,id=114494,bonus_id=114/560/563
hands=crystalhide_grips,id=116944
waist=cord_of_ruination,id=115430
legs=blackwater_leggings,id=109823,bonus_id=524
feet=boots_of_determined_resolve,id=114502,bonus_id=41/102/560
finger1=darkflame_loop,id=109766,bonus_id=524,enchant=30crit
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=50crit
trinket1=emblem_of_gushing_wounds,id=116290
trinket2=sandmans_pouch,id=112320,bonus_id=525/529
main_hand=spire_of_the_furious_construct,id=110031,bonus_id=41/524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_stamina=2763
# gear_intellect=2192
# gear_spell_power=958
# gear_crit_rating=742
# gear_haste_rating=627
# gear_mastery_rating=690
# gear_armor=866
# gear_multistrike_rating=315
# gear_versatility_rating=407
# gear_leech_rating=182

Kernoris

Kernoris : 21251 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
21250.7 21250.7 9.2 / 0.043% 2903.0 / 13.7% 1331.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.9 15.9 Energy 38.87% 39.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Kernoris/advanced
Talents
  • 15: Wild Charge
  • 30: Ysera's Gift
  • 45: Typhoon
  • 60: Soul of the Forest (Feral Druid)
  • 75: Mighty Bash
  • 90: Dream of Cenarius (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Glyphs
  • Glyph of Savage Roar
  • Glyph of Cat Form
  • Glyph of Ferocious Bite
  • Glyph of Grace
  • Glyph of Travel
  • Glyph of Aquatic Form
Professions
  • alchemy: 700
  • herbalism: 700

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Kernoris+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:133388|74723|45276|27849|12421|5135&chds=0,266776&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++133388++rip,C79C6E,0,0,15|t++74723++ferocious_bite,C79C6E,1,0,15|t++45276++rake,C79C6E,2,0,15|t++27849++thrash_cat,C79C6E,3,0,15|t++12421++shred,C79C6E,4,0,15|t++5135++cat_melee,C79C6E,5,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Kernoris+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,20,19,17,17,3,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cat_melee|rip|shred|ferocious_bite|rake|shattered_bleed|thrash_cat&
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Kernoris+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:eimoquy258776555221xurpoomkjihjijiijjjjjjjjiihgfedcccdddeeefffffffggggfefddcbaaaaaabbcddddeeddeeeeeeeeedccaaaaaaabbbcccccccdddddddeeeeeddddddddccdddddccddddddddddddddccccccbbccddefghijklmnopqrrrrrrqponmlkkjjiiihiihhhhhhiiiiihhhggffeeeeffffgghhhiiiiijjjjjjjjjiihhhhhhhiiijkkkkkklllllllllkkjjiiihhhhhiijjkkkkllmmmmmmmmmmlkkkjjjiiijjkkkllllllllkklkkkjihhggfeeddddddddcaZYWVTSQP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.573435,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=21251|max=37059&chxp=1,1,57,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Kernoris+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:9,8,16,32,46,72,130,168,279,375,479,623,719,856,1089,1317,1423,1530,1587,1499,1586,1489,1434,1220,1213,1031,916,753,689,523,423,360,295,228,156,135,89,51,47,29,24,23,6,12,1,4,1,2,2,1&chds=0,1587&chbh=5&chxt=x&chxl=0:|min=18903|avg=21251|max=24644&chxp=0,1,41,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Kernoris+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:32.9,9.4,7.8,4.7,3.1,2.6,0.8,38.9&chds=0,100&chdls=ffffff&chco=C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=shred 99.1s|healing_touch 28.2s|rake 23.3s|ferocious_bite 14.1s|rip 9.4s|savage_roar 7.7s|thrash_cat 2.5s|waiting 117.0s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Kernoris 21251
cat_melee 5137 24.2% 355.3 0.85sec 4345 5135 Direct 355.3 3221 6444 4151 28.9% 55.3 967 1933 28.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 355.26 355.26 0.00 0.00 0.8463 0.0000 1543683.22 2372397.37 34.93 5134.54 5134.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 15.94 28.83% 1932.79 1280 2522 1934.00 1750 2258 30816 47359 34.93
multistrike 39.35 71.17% 966.52 640 1261 967.11 913 1056 38037 58456 34.93
hit 252.71 71.14% 3221.24 2134 4203 3223.17 3159 3305 814059 1251080 34.93
crit 102.54 28.86% 6443.98 4268 8406 6447.80 6207 6779 660772 1015502 34.93
 
DPS Timeline Chart
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
ferocious_bite 3536 16.6% 14.1 21.57sec 75058 74723 Direct 14.1 45477 90927 71726 57.8% 2.2 13635 27287 57.5%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.08 14.08 0.00 0.00 1.0045 0.0000 1056952.36 1624368.89 34.93 74722.68 74722.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.26 57.50% 27286.79 2013 36775 19671.88 0 36775 34269 52666 25.16
multistrike 0.93 42.50% 13634.62 1006 18388 8262.45 0 18388 12655 19448 21.18
hit 5.95 42.25% 45477.23 3274 61292 45518.51 0 61292 270560 415808 34.90
crit 8.13 57.75% 90927.41 6548 122584 91104.49 47951 122584 739469 1136447 34.93
 
DPS Timeline Chart
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point{$?s67598=true}[, consumes up to 25 additional Energy to increase damage by up to 100%, and heals you for $67598m1% of your total maximum health for each $67598m2 Energy used.][ and consumes up to 25 additional Energy to increase damage by up to 100%.]{$?s1079=true}[ When used on targets below 25% health, Ferocious Bite will also refresh the duration of your Rip on your target.][] Critical strike chance doubled against bleeding targets. 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
rake 3515 16.6% 23.2 13.05sec 45479 45276 Direct 23.2 6306 12606 8126 28.9% 3.6 1891 3786 29.1%  
Periodic 99.0 6422 12855 8280 28.9% 15.3 1971 3949 28.9% 98.7%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.22 23.22 98.97 98.97 1.0045 3.0000 1055966.17 1055966.17 0.00 3297.53 45275.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.05 29.06% 3786.14 2377 8654 2457.00 0 8654 3967 3967 0.00
multistrike 2.56 70.94% 1890.65 931 4327 1752.71 0 4327 4837 4837 0.00
hit 16.51 71.10% 6305.85 3103 14423 6321.10 5271 7642 104107 104107 0.00
crit 6.71 28.90% 12606.46 6206 28846 12629.87 0 28846 84579 84579 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.4 28.90% 3949.33 2607 8654 3903.20 0 8654 17501 17501 0.00
multistrike 10.9 71.10% 1971.25 1303 4327 1973.89 0 3534 21487 21487 0.00
hit 70.4 71.11% 6422.07 2 14423 6432.29 5725 7239 451991 451991 0.00
crit 28.6 28.89% 12854.92 4 28846 12875.22 10606 16531 367495 367495 0.00
 
DPS Timeline Chart
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}. Awards {$s2=1} combo $lpoint:points;. If used while stealthed, the target will be stunned for {$163505d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
rip 4161 19.6% 9.4 24.97sec 133988 133388 Periodic 143.1 6496 12993 8368 28.8% 22.2 1948 3899 28.9% 95.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.35 9.35 143.06 143.06 1.0045 2.0000 1253044.77 1253044.77 0.00 4240.14 133387.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.4 28.85% 3899.22 2800 5347 3885.99 0 5347 25025 25025 0.00
multistrike 15.8 71.15% 1947.81 1400 2673 1946.85 1470 2385 30828 30828 0.00
hit 101.8 71.19% 6496.36 3416 8911 6493.17 5502 7116 661617 661617 0.00
crit 41.2 28.81% 12993.20 5182 17822 12986.50 10502 14653 535576 535576 0.00
 
DPS Timeline Chart
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<3&target.time_to_die-remains>18
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>)*8} damage 2 points: ${$floor(2*$<rip>)*8} damage 3 points: ${$floor(3*$<rip>)*8} damage 4 points: ${$floor(4*$<rip>)*8} damage 5 points: ${$floor(5*$<rip>)*8} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.086000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 569 2.7% 17.5 17.53sec 9790 0 Direct 17.5 2303 4608 2970 28.9% 2.7 691 1382 28.6%  
Periodic 98.2 1135 0 1135 0.0% 15.3 346 0 0.0% 32.6%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.47 17.47 98.18 98.18 0.0000 1.0000 171053.32 171053.32 0.00 1742.30 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.78 28.59% 1382.29 951 1531 742.02 0 1531 1072 1072 0.00
multistrike 1.94 71.41% 691.34 475 766 588.55 0 766 1339 1339 0.00
hit 12.42 71.08% 2303.44 1585 2552 2303.18 2140 2496 28608 28608 0.00
crit 5.05 28.92% 4608.47 3170 5103 4581.23 0 5103 23284 23284 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 15.3 100.00% 345.77 238 383 345.74 314 383 5284 5284 0.00
hit 98.2 100.00% 1135.36 0 1276 1135.77 1070 1224 111467 111467 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shred 4104 19.3% 98.6 3.05sec 12477 12421 Direct 98.6 9252 18496 11920 28.9% 15.3 2775 5549 28.9%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.62 98.62 0.00 0.00 1.0045 0.0000 1230428.27 1890973.97 34.93 12420.79 12420.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.44 28.91% 5548.62 3441 8812 5482.05 0 8812 24620 37838 34.48
multistrike 10.91 71.09% 2774.74 1721 4406 2777.50 2409 3831 30278 46533 34.93
hit 70.15 71.13% 9251.57 5736 14686 9260.40 8779 9858 649022 997444 34.93
crit 28.47 28.87% 18495.68 11471 29373 18507.89 16300 20610 526508 809160 34.93
 
DPS Timeline Chart
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<3
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target{$?s48484=false}[ and reducing the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}][]. Awards {$s2=1} combo $lpoint:points;. Being stealthed increases damage by $5215m4% and doubles critical strike chance. Damage increased by {$106785s2=20}% against bleeding targets.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.00
 
thrash_cat 229 1.1% 2.5 61.73sec 27974 27849 Direct 2.5 4593 9184 5911 28.7% 0.4 1379 2757 29.0%  
Periodic 12.1 3283 6563 4225 28.7% 1.9 986 1970 28.9% 12.1%

Stats details: thrash_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.46 2.46 12.14 12.14 1.0045 3.0000 68926.48 68926.48 0.00 1772.03 27849.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.11 29.01% 2756.59 2053 3919 287.26 0 3919 305 305 0.00
multistrike 0.27 70.99% 1379.12 1026 1959 320.39 0 1959 374 374 0.00
hit 1.76 71.29% 4593.29 3422 6532 3881.65 0 6532 8068 8068 0.00
crit 0.71 28.71% 9183.79 6843 13063 4764.61 0 13063 6497 6497 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.5 28.91% 1969.80 1467 2800 768.58 0 2800 1068 1068 0.00
multistrike 1.3 71.09% 985.70 733 1400 648.57 0 1400 1315 1315 0.00
hit 8.7 71.27% 3283.26 2445 4667 3055.73 0 4667 28412 28412 0.00
crit 3.5 28.73% 6562.88 4889 9333 5793.22 0 9333 22888 22888 0.00
 
DPS Timeline Chart
 

Action details: thrash_cat

Static Values
  • id:106830
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.omen_of_clarity.react&remains<4.5&active_enemies>1
Spelldata
  • id:106830
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:Strikes all enemy targets within $A2 yards, dealing $m1 bleed damage and an additional $o2 damage over {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.315000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.225000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Kernoris
berserk 2.0 183.31sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.43 71.18% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.58 28.82% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: berserk

Static Values
  • id:106952
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106952
  • name:Berserk
  • school:physical
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
 
cat_form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.71 70.96% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.29 29.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:2368.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}%.$?$w2=100, and reduces falling damage.[ Additionally, all healing done to you is increased by {$47180s1=20}%][]
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}% and allowing the use of Cat Form abilities. Also protects the caster from Polymorph effects and reduces damage taken from falling.{$?s47180=true}[ Additionally, all healing done to you is increased by {$47180s1=20}%.][] The act of shapeshifting frees the caster of movement impairing effects.
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
healing_touch 29.1 10.54sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 29.11 29.11 0.00 0.00 0.9700 0.0000 0.00 951993.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.45 31.96% 0.00 0 0 0.00 0 0 0 20749 77.04
multistrike 3.09 68.04% 0.00 0 0 0.00 0 0 0 22058 95.58
hit 19.83 68.10% 0.00 0 0 0.00 0 0 0 469300 100.00
crit 9.29 31.90% 0.00 0 0 0.00 0 0 0 439886 100.00
 
HPS Timeline Chart
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3312.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Kernoris
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}{$?s54825=false}[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}[ Healing increased by 50% when cast on self.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.600000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
leader_of_the_pack 39.9 7.62sec

Stats details: leader_of_the_pack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 39.91 39.91 0.00 0.00 0.0000 0.0000 0.00 328767.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.91 100.00% 0.00 0 0 0.00 0 0 0 328767 100.00
 
HPS Timeline Chart
 

Action details: leader_of_the_pack

Static Values
  • id:68285
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kernoris
  • harmful:false
  • if_expr:
Spelldata
  • id:68285
  • name:Leader of the Pack
  • school:physical
  • tooltip:
  • description:{$@spelldesc17007=While in Bear Form or Cat Form, increases critical strike chance of all party and raid members within $24932a1 yards by {$24932s1=5}%. Also causes your melee critical strikes to heal you for {$68285s1=3}% of your health. This effect cannot occur more than once every 6 sec.}
 
savage_roar 7.7 37.65sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.66 7.66 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 7.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.savage_roar.remains<3
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=40}% while in Cat Form. Lasts longer per combo point: 1 point : ${18+$<bonus>} seconds 2 points: ${24+$<bonus>} seconds 3 points: ${30+$<bonus>} seconds 4 points: ${36+$<bonus>} seconds 5 points: ${42+$<bonus>} seconds
 
tigers_fury 10.2 30.54sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.23 10.23 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.27 71.11% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.95 28.89% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=8 seconds} and instantly restores {$s2=60} Energy.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
berserk 2.0 0.0 183.3sec 183.3sec 10.15% 16.45% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserk_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106952
  • name:Berserk
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodtalons 29.1 0.0 10.5sec 10.5sec 37.91% 38.59% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodtalons_1:22.63%
  • bloodtalons_2:15.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=30}% additional damage.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=30}% additional damage.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
draenic_agility_potion 2.0 0.0 257.3sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
omen_of_clarity (omen_of_clarity) 20.3 0.4 14.2sec 13.9sec 4.04% 13.67% 0.4(0.4)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_omen_of_clarity
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • omen_of_clarity_1:4.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Your next Cat Form ability has {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your autoattacks have a chance to reduce the Energy cost of your next Cat Form ability by {$16870s1=100}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
predatory_swiftness 28.8 0.8 10.4sec 10.1sec 61.65% 100.00% 0.8(0.8)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • predatory_swiftness_1:61.65%

Trigger Attempt Success

  • trigger_pct:95.27%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms, and heal for {$s4=20}% more.
  • description:{$@spelldesc16974=Your finishing moves have a $b3% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms, and to increase the healing done by Healing Touch by {$69369s4=20}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.13% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.$?$w2>=0[][ Movement speed slowed by $w2%.]
  • description:Activates Cat Form and places the Druid into stealth{$?s157274=false}[][, but reduces movement speed by {$s2=30}%]. Lasts until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
tigers_fury 10.2 0.0 30.5sec 30.5sec 26.85% 28.80% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=8 seconds} and instantly restores {$s2=60} Energy.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
cat_form

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • cat_form_1:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}%.$?$w2=100, and reduces falling damage.[ Additionally, all healing done to you is increased by {$47180s1=20}%][]
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}% and allowing the use of Cat Form abilities. Also protects the caster from Polymorph effects and reduces damage taken from falling.{$?s47180=true}[ Additionally, all healing done to you is increased by {$47180s1=20}%.][] The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
savage_roar

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • savage_roar_1:99.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=40}% while in Cat Form. Lasts longer per combo point: 1 point : ${18+$<bonus>} seconds 2 points: ${24+$<bonus>} seconds 3 points: ${30+$<bonus>} seconds 4 points: ${36+$<bonus>} seconds 5 points: ${42+$<bonus>} seconds
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Snapshotting Details

Ability Tiger's Fury Bloodtalons
Name Execute % Benefit % Execute % Benefit %
ferocious_bite36.05 %36.05 % 86.00 %86.00 %
rake37.74 %48.15 % 81.83 %92.52 %
rip38.52 %39.73 % 84.94 %89.49 %
shred33.67 %33.67 % 16.61 %16.61 %
thrash_cat (_cat)23.71 %23.60 % 94.42 %94.57 %
Improved Rake
Execute %4.31 %
Benefit %4.50 %
Wasted Buffs0.00

Resources

Resource Usage Type Count Total Average RPE APR
Kernoris
ferocious_bite Energy 28.2 576.1 20.5 40.9 1834.5
rake Energy 23.2 684.1 29.5 29.5 1543.6
rip Energy 9.4 232.2 24.8 24.8 5396.3
savage_roar Energy 7.7 186.4 24.3 24.3 0.0
shred Energy 98.6 3112.4 31.6 31.6 395.3
Resource Gains Type Count Total Average Overflow
leader_of_the_pack Health 39.91 0.00 (0.00%) 0.00 328764.88 100.00%
yseras_gift Health 4.41 0.00 (0.00%) 0.00 47598.87 100.00%
healing_touch Health 33.65 0.00 (0.00%) 0.00 951993.60 100.00%
glyph_of_ferocious_bite Health 14.08 0.00 (0.00%) 0.00 271784.84 100.00%
energy_regen Energy 1026.35 3526.70 (64.39%) 3.44 25.39 0.71%
mp5_regen Mana 1026.35 0.00 (0.00%) 0.00 153876.64 100.00%
omen_of_clarity Energy 20.31 749.74 (13.69%) 36.91 0.00 0.00%
primal_fury Combo Points 35.17 35.17 (23.34%) 1.00 0.00 0.00%
rake Combo Points 23.22 19.90 (13.21%) 0.86 3.32 14.28%
shred Combo Points 98.62 95.61 (63.45%) 0.97 3.01 3.05%
soul_of_the_forest Energy 31.10 587.06 (10.72%) 18.88 5.11 0.86%
tigers_fury Energy 10.23 613.69 (11.20%) 60.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 15.71 15.92
Combo Points 0.50 0.49
Combat End Resource Mean Min Max
Mana 32000.00 32000.00 32000.00
Rage 0.00 0.00 0.00
Energy 21.23 0.01 100.00
Combo Points 2.64 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%

Procs

Count Interval
primal_fury 35.2 8.5sec

Statistics & Data Analysis

Fight Length
Sample Data Kernoris Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Kernoris Damage Per Second
Count 25000
Mean 21250.73
Minimum 18903.30
Maximum 24644.11
Spread ( max - min ) 5740.81
Range [ ( max - min ) / 2 * 100% ] 13.51%
Standard Deviation 739.2929
5th Percentile 20080.79
95th Percentile 22524.12
( 95th Percentile - 5th Percentile ) 2443.33
Mean Distribution
Standard Deviation 4.6757
95.00% Confidence Intervall ( 21241.56 - 21259.89 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4649
0.1 Scale Factor Error with Delta=300 4665
0.05 Scale Factor Error with Delta=300 18662
0.01 Scale Factor Error with Delta=300 466569
Distribution Chart
DPS(e)
Sample Data Kernoris Damage Per Second (Effective)
Count 25000
Mean 21250.73
Minimum 18903.30
Maximum 24644.11
Spread ( max - min ) 5740.81
Range [ ( max - min ) / 2 * 100% ] 13.51%
Damage
Sample Data Kernoris Damage
Count 25000
Mean 6380054.59
Minimum 4737208.81
Maximum 8295175.19
Spread ( max - min ) 3557966.38
Range [ ( max - min ) / 2 * 100% ] 27.88%
DTPS
Sample Data Kernoris Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Kernoris Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Kernoris Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Kernoris Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Kernoris Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Kernoris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data KernorisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Kernoris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 cat_form
9 0.00 wild_charge
A 0.00 displacer_beast,if=movement.distance>10
B 0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
C 1.00 rake,if=buff.prowl.up
D 1.00 auto_attack
E 0.00 skull_bash
F 0.00 force_of_nature,if=charges=3|trinket.proc.all.react|target.time_to_die<20
G 0.87 potion,name=draenic_agility,if=target.time_to_die<=40
H 0.00 blood_fury,sync=tigers_fury
I 0.00 berserking,sync=tigers_fury
J 0.00 arcane_torrent,sync=tigers_fury
K 10.23 tigers_fury,if=(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
L 0.00 incarnation,if=cooldown.berserk.remains<10&energy.time_to_max>1
M 0.13 potion,name=draenic_agility,sync=berserk,if=target.health.pct<25
N 2.01 berserk,if=buff.tigers_fury.up
O 0.31 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
Keep Rip from falling off during execute range.
P 28.11 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=4|buff.predatory_swiftness.remains<1.5)
Q 4.48 savage_roar,if=buff.savage_roar.remains<3
R 0.00 thrash_cat,cycle_targets=1,if=buff.omen_of_clarity.react&remains<4.5&active_enemies>1
S 0.00 thrash_cat,cycle_targets=1,if=!talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
T 0.00 pool_resource,for_next=1
U 0.00 thrash_cat,cycle_targets=1,if=remains<4.5&active_enemies>1
V 0.00 call_action_list,name=finisher,if=combo_points=5
W 0.00 call_action_list,name=maintain
X 0.00 call_action_list,name=generator,if=combo_points<5
actions.finisher
# count action,conditions
Y 5.22 ferocious_bite,cycle_targets=1,max_energy=1,if=target.health.pct<25&dot.rip.ticking
Z 7.28 rip,cycle_targets=1,if=remains<3&target.time_to_die-remains>18
a 2.07 rip,cycle_targets=1,if=remains<7.2&persistent_multiplier>dot.rip.pmultiplier&target.time_to_die-remains>18
b 3.19 savage_roar,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)&buff.savage_roar.remains<12.6
c 8.55 ferocious_bite,max_energy=1,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)
actions.maintain
# count action,conditions
d 0.00 rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<3&combo_points<5&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
e 0.00 rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<4.5&combo_points<5&persistent_multiplier>dot.rake.pmultiplier&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
f 13.78 rake,cycle_targets=1,if=talent.bloodtalons.enabled&remains<4.5&combo_points<5&(!buff.predatory_swiftness.up|buff.bloodtalons.up|persistent_multiplier>dot.rake.pmultiplier)&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
g 2.46 thrash_cat,cycle_targets=1,if=talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
h 0.00 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<4.2&active_enemies<6&target.time_to_die-remains>tick_time*5
i 8.44 rake,cycle_targets=1,if=persistent_multiplier>dot.rake.pmultiplier&combo_points<5&active_enemies=1
actions.generator
# count action,conditions
j 0.00 swipe,if=active_enemies>=3
k 98.62 shred,if=active_enemies<3

Sample Sequence

013457CDkkkkKNZkkPkckkkkPfckkPkakkkkPfgbkkKkPcikkkPkZkkkPfckkKkPigbkkkPZkkkPfckkKkPfZkkkPkbfkPkgZkkKkPfgckkkPfakkkPKibkkkkPkgZkkfkPcKNikkkPakkkPkbkkkPfckkkPkckKkkPOfkkPYkkkfPibkKkkkPiGYkkkkPfYkkKkPiYkkkPQkk

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre healing_touch Kernoris 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2), draenic_agility_potion
0:00.000 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodtalons(2), draenic_agility_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 65.0/100: 65% energy | 1.0/5: 20% combo_points bloodtalons, draenic_agility_potion
0:01.004 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.8/100: 80% energy | 1.0/5: 20% combo_points bloodlust, bloodtalons, draenic_agility_potion
0:02.008 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.7/100: 55% energy | 2.0/5: 40% combo_points bloodlust, draenic_agility_potion
0:03.013 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.5/100: 29% energy | 3.0/5: 60% combo_points bloodlust, omen_of_clarity, draenic_agility_potion
0:04.017 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.3/100: 44% energy | 4.0/5: 80% combo_points bloodlust, draenic_agility_potion
0:05.021 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 19.1/100: 19% energy | 5.0/5: 100% combo_points bloodlust, draenic_agility_potion
0:05.021 berserk Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.1/100: 79% energy | 5.0/5: 100% combo_points bloodlust, tigers_fury, draenic_agility_potion
0:05.021 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.1/150: 53% energy | 5.0/5: 100% combo_points bloodlust, berserk, tigers_fury, draenic_agility_potion
0:06.025 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 99.0/150: 66% energy | 0.0/5: 0% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:07.027 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 93.8/150: 63% energy | 2.0/5: 40% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:08.032 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 88.6/150: 59% energy | 4.0/5: 80% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:09.037 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 103.4/150: 69% energy | 4.0/5: 80% combo_points bloodlust, berserk, bloodtalons(2), tigers_fury, draenic_agility_potion
0:10.041 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 98.3/150: 66% energy | 5.0/5: 100% combo_points bloodlust, berserk, bloodtalons, tigers_fury, draenic_agility_potion
0:11.045 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 108.1/150: 72% energy | 0.0/5: 0% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:12.049 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 102.9/150: 69% energy | 1.0/5: 20% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:13.054 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 97.8/150: 65% energy | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:14.059 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.6/150: 62% energy | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:15.062 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 87.4/150: 58% energy | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:16.067 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 102.3/150: 68% energy | 4.0/5: 80% combo_points bloodlust, berserk, bloodtalons(2), draenic_agility_potion
0:17.072 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 99.6/150: 66% energy | 5.0/5: 100% combo_points bloodlust, berserk, bloodtalons, draenic_agility_potion
0:18.076 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 109.4/150: 73% energy | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:19.081 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 104.3/150: 70% energy | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:20.086 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 99.1/100: 99% energy | 4.0/5: 80% combo_points bloodlust, predatory_swiftness
0:21.090 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 4.0/5: 80% combo_points bloodlust, bloodtalons(2)
0:22.093 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 74.8/100: 75% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons
0:23.097 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.6/100: 80% energy | 0.0/5: 0% combo_points bloodlust, predatory_swiftness
0:24.100 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.4/100: 54% energy | 1.0/5: 20% combo_points bloodlust, omen_of_clarity, predatory_swiftness
0:25.105 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 69.3/100: 69% energy | 2.0/5: 40% combo_points bloodlust, predatory_swiftness
0:26.107 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.1/100: 44% energy | 3.0/5: 60% combo_points bloodlust, predatory_swiftness
0:27.111 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 18.9/100: 19% energy | 4.0/5: 80% combo_points bloodlust, predatory_swiftness
0:28.116 Waiting 0.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 33.7/100: 34% energy | 4.0/5: 80% combo_points bloodlust, bloodtalons(2)
0:28.216 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodlust, bloodtalons(2)
0:29.219 Waiting 1.974 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.0/100: 15% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons
0:31.193 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.2/100: 44% energy | 5.0/5: 100% combo_points bloodlust, omen_of_clarity, bloodtalons
0:32.197 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 59.0/100: 59% energy | 5.0/5: 100% combo_points bloodlust
0:33.202 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 68.9/100: 69% energy | 0.0/5: 0% combo_points bloodlust, predatory_swiftness
0:34.208 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.7/100: 44% energy | 1.0/5: 20% combo_points bloodlust, predatory_swiftness
0:35.213 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 18.5/100: 19% energy | 3.0/5: 60% combo_points bloodlust, predatory_swiftness
0:35.213 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 78.5/100: 79% energy | 3.0/5: 60% combo_points bloodlust, tigers_fury, predatory_swiftness
0:36.216 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 53.4/100: 53% energy | 5.0/5: 100% combo_points bloodlust, tigers_fury, predatory_swiftness
0:37.221 Waiting 1.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 68.2/100: 68% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), tigers_fury
0:38.421 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.9/100: 86% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), tigers_fury
0:39.426 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.8/100: 71% energy | 0.0/5: 0% combo_points bloodlust, bloodtalons, tigers_fury, predatory_swiftness
0:40.429 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.6/100: 51% energy | 1.0/5: 20% combo_points bloodlust, omen_of_clarity, tigers_fury, predatory_swiftness
0:41.433 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 62.0/100: 62% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
0:42.437 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 33.4/100: 33% energy | 3.0/5: 60% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
0:43.442 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.8/100: 45% energy | 4.0/5: 80% combo_points predatory_swiftness
0:44.446 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.2/100: 56% energy | 4.0/5: 80% combo_points bloodtalons(2)
0:45.450 Waiting 4.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.6/100: 28% energy | 5.0/5: 100% combo_points bloodtalons
0:50.050 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.9/100: 80% energy | 5.0/5: 100% combo_points bloodtalons
0:51.055 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 81.3/100: 81% energy | 0.0/5: 0% combo_points predatory_swiftness
0:52.062 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 52.7/100: 53% energy | 1.0/5: 20% combo_points predatory_swiftness
0:53.066 Waiting 0.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 24.1/100: 24% energy | 2.0/5: 40% combo_points predatory_swiftness
0:53.866 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 33.2/100: 33% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
0:54.869 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.6/100: 45% energy | 4.0/5: 80% combo_points predatory_swiftness
0:55.873 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.0/100: 56% energy | 4.0/5: 80% combo_points bloodtalons(2)
0:56.879 Waiting 5.000 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.4/100: 32% energy | 5.0/5: 100% combo_points bloodtalons
1:01.879 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.2/100: 89% energy | 5.0/5: 100% combo_points bloodtalons
1:02.885 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.6/100: 71% energy | 0.0/5: 0% combo_points predatory_swiftness
1:03.890 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 42.1/100: 42% energy | 1.0/5: 20% combo_points predatory_swiftness
1:04.896 Waiting 1.013 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 13.5/100: 13% energy | 3.0/5: 60% combo_points predatory_swiftness
1:05.909 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 3.0/5: 60% combo_points predatory_swiftness
1:05.909 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.0/100: 85% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
1:06.914 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.4/100: 56% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
1:07.918 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.8/100: 68% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
1:08.922 Waiting 0.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.2/100: 44% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons, tigers_fury
1:09.222 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 47.6/100: 48% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons, tigers_fury
1:10.227 Waiting 2.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 59.0/100: 59% energy | 5.0/5: 100% combo_points omen_of_clarity, tigers_fury
1:12.927 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.7/100: 90% energy | 5.0/5: 100% combo_points omen_of_clarity, tigers_fury
1:13.932 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 96.1/100: 96% energy | 0.0/5: 0% combo_points omen_of_clarity, predatory_swiftness
1:14.937 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 1.0/5: 20% combo_points predatory_swiftness
1:15.941 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.4/100: 71% energy | 3.0/5: 60% combo_points predatory_swiftness
1:16.945 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 42.8/100: 43% energy | 5.0/5: 100% combo_points predatory_swiftness
1:17.949 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.2/100: 54% energy | 5.0/5: 100% combo_points bloodtalons(2)
1:18.954 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 55.6/100: 56% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:19.958 Waiting 1.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.0/100: 27% energy | 1.0/5: 20% combo_points predatory_swiftness
1:21.158 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness
1:22.162 Waiting 1.638 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.1/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
1:23.800 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.7/100: 31% energy | 3.0/5: 60% combo_points omen_of_clarity, predatory_swiftness
1:24.805 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 42.1/100: 42% energy | 4.0/5: 80% combo_points predatory_swiftness
1:25.810 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 53.5/100: 54% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:26.815 Waiting 5.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.9/100: 30% energy | 5.0/5: 100% combo_points bloodtalons
1:32.015 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.0/100: 89% energy | 5.0/5: 100% combo_points bloodtalons
1:33.020 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.4/100: 70% energy | 0.0/5: 0% combo_points predatory_swiftness
1:34.026 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.8/100: 42% energy | 1.0/5: 20% combo_points predatory_swiftness
1:35.029 Waiting 1.036 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 13.2/100: 13% energy | 2.0/5: 40% combo_points predatory_swiftness
1:36.065 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 2.0/5: 40% combo_points predatory_swiftness
1:36.065 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.0/100: 85% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
1:37.070 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.4/100: 56% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
1:38.073 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.8/100: 68% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
1:39.077 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.2/100: 44% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
1:40.082 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 45.6/100: 46% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
1:41.086 Waiting 2.102 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 17.0/100: 17% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
1:43.188 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
1:44.192 Waiting 2.517 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
1:46.709 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
1:47.715 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points omen_of_clarity, predatory_swiftness
1:48.717 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points omen_of_clarity, bloodtalons(2)
1:49.721 Waiting 4.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.1/100: 35% energy | 5.0/5: 100% combo_points bloodtalons
1:54.521 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.6/100: 90% energy | 5.0/5: 100% combo_points bloodtalons
1:55.527 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 96.1/100: 96% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:56.532 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.5/100: 72% energy | 2.0/5: 40% combo_points predatory_swiftness
1:57.536 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.9/100: 44% energy | 4.0/5: 80% combo_points predatory_swiftness
1:58.541 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 55.3/100: 55% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:59.545 Waiting 2.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.7/100: 27% energy | 5.0/5: 100% combo_points bloodtalons
2:02.145 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.2/100: 56% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons
2:03.149 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.6/100: 68% energy | 5.0/5: 100% combo_points
2:04.155 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 69.1/100: 69% energy | 0.0/5: 0% combo_points predatory_swiftness
2:05.162 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.5/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
2:06.166 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.9/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
2:06.166 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.9/100: 72% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
2:07.172 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.3/100: 43% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
2:08.176 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.7/100: 55% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
2:09.181 Waiting 4.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.2/100: 31% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:13.881 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 84.5/100: 85% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons, tigers_fury
2:14.885 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 95.9/100: 96% energy | 5.0/5: 100% combo_points
2:15.890 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 77.4/100: 77% energy | 0.0/5: 0% combo_points predatory_swiftness
2:16.895 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 48.8/100: 49% energy | 2.0/5: 40% combo_points predatory_swiftness
2:17.900 Waiting 1.823 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 20.2/100: 20% energy | 3.0/5: 60% combo_points predatory_swiftness
2:19.723 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
2:20.727 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
2:21.732 Waiting 1.212 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:22.944 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.5/100: 37% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:23.948 Waiting 1.478 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 13.9/100: 14% energy | 5.0/5: 100% combo_points bloodtalons
2:25.426 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.7/100: 31% energy | 5.0/5: 100% combo_points bloodtalons
2:26.432 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.1/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
2:27.132 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.1/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness
2:28.137 Waiting 2.591 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.5/100: 11% energy | 1.0/5: 20% combo_points predatory_swiftness
2:30.728 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness
2:31.733 Waiting 2.516 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
2:34.249 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
2:35.253 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
2:36.258 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:36.258 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 83.7/100: 84% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
2:37.264 Waiting 2.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 60.1/100: 60% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:39.864 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.7/100: 90% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:40.869 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 96.1/100: 96% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
2:41.873 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.5/100: 67% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
2:42.876 Waiting 0.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.9/100: 39% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
2:42.976 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.0/100: 40% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
2:43.981 Waiting 1.693 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.4/100: 11% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
2:45.674 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.7/100: 31% energy | 3.0/5: 60% combo_points omen_of_clarity, predatory_swiftness
2:46.679 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 42.1/100: 42% energy | 4.0/5: 80% combo_points predatory_swiftness
2:47.685 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 53.5/100: 54% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:48.690 Waiting 1.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 24.9/100: 25% energy | 5.0/5: 100% combo_points bloodtalons
2:50.490 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 45.4/100: 45% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons
2:51.494 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.8/100: 57% energy | 5.0/5: 100% combo_points
2:52.497 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 58.2/100: 58% energy | 0.0/5: 0% combo_points predatory_swiftness
2:53.502 Waiting 1.000 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.6/100: 30% energy | 1.0/5: 20% combo_points predatory_swiftness
2:54.502 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness
2:55.506 Waiting 2.013 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.4/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
2:57.519 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 2.0/5: 40% combo_points predatory_swiftness
2:58.522 Waiting 2.578 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
3:01.100 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
3:02.105 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
3:03.108 Waiting 2.414 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 5.0/5: 100% combo_points bloodtalons(2)
3:05.522 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.1/100: 51% energy | 5.0/5: 100% combo_points bloodtalons(2)
3:06.525 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 33% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:06.525 berserk Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.5/100: 93% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
3:06.525 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.5/150: 62% energy | 0.0/5: 0% combo_points berserk, bloodtalons, tigers_fury, predatory_swiftness
3:07.530 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 86.4/150: 58% energy | 1.0/5: 20% combo_points berserk, tigers_fury, predatory_swiftness
3:08.536 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 77.9/150: 52% energy | 2.0/5: 40% combo_points berserk, omen_of_clarity, tigers_fury, predatory_swiftness
3:09.541 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.3/150: 60% energy | 3.0/5: 60% combo_points berserk, tigers_fury, predatory_swiftness
3:10.546 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 80.7/150: 54% energy | 5.0/5: 100% combo_points berserk, tigers_fury, predatory_swiftness
3:11.550 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.1/150: 61% energy | 5.0/5: 100% combo_points berserk, bloodtalons(2), tigers_fury
3:12.554 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 108.5/150: 72% energy | 0.0/5: 0% combo_points berserk, bloodtalons, tigers_fury, predatory_swiftness
3:13.558 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 99.9/150: 67% energy | 1.0/5: 20% combo_points berserk, tigers_fury, predatory_swiftness
3:14.563 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 91.3/150: 61% energy | 2.0/5: 40% combo_points berserk, predatory_swiftness
3:15.568 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 82.7/150: 55% energy | 4.0/5: 80% combo_points berserk, predatory_swiftness
3:16.573 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 94.2/150: 63% energy | 4.0/5: 80% combo_points berserk, bloodtalons(2)
3:17.577 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.6/150: 57% energy | 5.0/5: 100% combo_points berserk, bloodtalons
3:18.580 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 104.4/150: 70% energy | 0.0/5: 0% combo_points berserk, bloodtalons, predatory_swiftness
3:19.584 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 95.9/150: 64% energy | 2.0/5: 40% combo_points berserk, predatory_swiftness
3:20.589 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 87.3/150: 58% energy | 3.0/5: 60% combo_points berserk, predatory_swiftness
3:21.591 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 78.7/100: 79% energy | 4.0/5: 80% combo_points omen_of_clarity, predatory_swiftness
3:22.595 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 90.1/100: 90% energy | 4.0/5: 80% combo_points omen_of_clarity, bloodtalons(2)
3:23.599 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons
3:24.603 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 86.4/100: 86% energy | 0.0/5: 0% combo_points predatory_swiftness
3:25.607 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 57.8/100: 58% energy | 1.0/5: 20% combo_points predatory_swiftness
3:26.610 Waiting 1.000 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.2/100: 29% energy | 2.0/5: 40% combo_points predatory_swiftness
3:27.610 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.6/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
3:28.616 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
3:29.622 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.4/100: 23% energy | 4.0/5: 80% combo_points omen_of_clarity, bloodtalons(2)
3:30.625 Waiting 3.000 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.8/100: 35% energy | 5.0/5: 100% combo_points bloodtalons
3:33.625 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 68.9/100: 69% energy | 5.0/5: 100% combo_points bloodtalons
3:34.631 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.3/100: 50% energy | 0.0/5: 0% combo_points predatory_swiftness
3:35.634 Waiting 0.990 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 21.7/100: 22% energy | 1.0/5: 20% combo_points predatory_swiftness
3:36.624 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.9/100: 33% energy | 1.0/5: 20% combo_points predatory_swiftness
3:36.624 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.9/100: 93% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
3:37.630 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 64.4/100: 64% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
3:38.634 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.8/100: 36% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
3:39.639 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 47.2/100: 47% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
3:40.643 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.4/100: 27% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
3:41.343 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.4/100: 35% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
3:42.348 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.8/100: 12% energy | 2.0/5: 40% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
3:43.353 Waiting 1.559 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.2/100: 23% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
3:44.912 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
3:45.916 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
3:46.921 Waiting 2.413 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 5.0/5: 100% combo_points bloodtalons(2)
3:49.334 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.1/100: 51% energy | 5.0/5: 100% combo_points bloodtalons(2)
3:50.339 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 33% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:51.039 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.5/100: 40% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:52.043 Waiting 1.353 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.9/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
3:53.396 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.3/100: 27% energy | 1.0/5: 20% combo_points omen_of_clarity, predatory_swiftness
3:54.400 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.7/100: 39% energy | 2.0/5: 40% combo_points predatory_swiftness
3:54.600 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
3:55.603 Waiting 2.015 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
3:57.618 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 3.0/5: 60% combo_points predatory_swiftness
3:58.622 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
3:59.625 Waiting 1.074 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.0/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:00.699 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:01.702 Waiting 1.978 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
4:03.680 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.1/100: 34% energy | 5.0/5: 100% combo_points bloodtalons
4:04.684 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.5/100: 40% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
4:05.690 Waiting 1.152 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.9/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
4:06.842 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 1.0/5: 20% combo_points predatory_swiftness
4:06.842 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.0/100: 85% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
4:07.847 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.4/100: 56% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
4:08.851 Waiting 1.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.8/100: 28% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
4:09.951 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.3/100: 40% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
4:10.954 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.7/100: 12% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
4:11.959 Waiting 1.065 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.1/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
4:13.024 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
4:14.027 Waiting 1.478 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
4:15.505 potion Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 28.4/100: 28% energy | 5.0/5: 100% combo_points bloodtalons
4:15.505 Waiting 2.000 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 28.4/100: 28% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:17.505 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.1/100: 51% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:18.508 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 33% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:19.208 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.5/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:20.212 Waiting 2.556 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.9/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness, draenic_agility_potion
4:22.768 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness, draenic_agility_potion
4:23.774 Waiting 1.315 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness, draenic_agility_potion
4:25.089 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.3/100: 27% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness, draenic_agility_potion
4:26.094 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.7/100: 39% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:26.294 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:27.298 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.4/100: 12% energy | 4.0/5: 80% combo_points omen_of_clarity, predatory_swiftness, draenic_agility_potion
4:28.303 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.8/100: 24% energy | 4.0/5: 80% combo_points omen_of_clarity, bloodtalons(2), draenic_agility_potion
4:29.307 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:29.507 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.4/100: 37% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons, draenic_agility_potion
4:30.511 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.8/100: 44% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:31.515 Waiting 2.257 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.3/100: 15% energy | 2.0/5: 40% combo_points predatory_swiftness, draenic_agility_potion
4:33.772 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness, draenic_agility_potion
4:34.778 Waiting 2.116 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:36.894 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 36.4/100: 36% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:36.894 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 96.4/100: 96% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:37.899 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.8/100: 68% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:38.903 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.2/100: 79% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury, draenic_agility_potion
4:39.908 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 55.6/100: 56% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury, draenic_agility_potion
4:40.912 Waiting 0.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.0/100: 37% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
4:41.212 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.4/100: 40% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
4:42.216 Waiting 2.561 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.8/100: 12% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
4:44.777 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
4:45.781 Waiting 2.518 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
4:48.299 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
4:49.303 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
4:50.307 Waiting 0.713 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:51.020 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.8/100: 32% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:52.025 Waiting 0.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.2/100: 34% energy | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness
4:52.625 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.0/100: 41% energy | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness
4:53.629 Waiting 2.505 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.4/100: 12% energy | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness
4:56.134 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness
4:57.137 Waiting 1.118 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 660 629 629
Agility 3981 3529 3426 (1204)
Stamina 3814 3468 3468
Intellect 1089 1038 1038
Spirit 781 781 781
Health 228840 208080 0
Mana 32000 32000 0
Rage 100 100 0
Energy 100 100 0
Combo Points 5 5 0
Crit 31.86% 25.91% 1090
Haste 13.59% 8.18% 818
Multistrike 7.77% 2.77% 183
Damage / Heal Versatility 5.66% 2.66% 346
ManaReg per Second 512 512 0
Attack Power 4379 3529 0
Mastery 49.61% 33.96% 313
Armor 816 816 816
Run Speed 0 0 95

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Feral Druid) Mass Entanglement Typhoon
60 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Force of Nature (Feral Druid)
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild (Feral Druid) Dream of Cenarius (Feral Druid) Nature's Vigil
100 Lunar Inspiration (Feral Druid) Bloodtalons (Feral Druid) Claws of Shirvallah (Feral Druid)

Profile

druid="Kernoris"
origin="http://eu.battle.net/wow/en/character/forscherliga/Kernoris/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/20/55011348-avatar.jpg"
level=100
race=worgen
role=attack
position=back
professions=alchemy=700/herbalism=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#UZ!2020211
glyphs=savage_roar/cat_form/ferocious_bite/grace/travel/aquatic_form
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/force_of_nature,if=charges=3|trinket.proc.all.react|target.time_to_die<20
actions+=/potion,name=draenic_agility,if=target.time_to_die<=40
actions+=/blood_fury,sync=tigers_fury
actions+=/berserking,sync=tigers_fury
actions+=/arcane_torrent,sync=tigers_fury
actions+=/tigers_fury,if=(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
actions+=/incarnation,if=cooldown.berserk.remains<10&energy.time_to_max>1
actions+=/potion,name=draenic_agility,sync=berserk,if=target.health.pct<25
actions+=/berserk,if=buff.tigers_fury.up
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=4|buff.predatory_swiftness.remains<1.5)
actions+=/savage_roar,if=buff.savage_roar.remains<3
actions+=/thrash_cat,cycle_targets=1,if=buff.omen_of_clarity.react&remains<4.5&active_enemies>1
actions+=/thrash_cat,cycle_targets=1,if=!talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
actions+=/pool_resource,for_next=1
actions+=/thrash_cat,cycle_targets=1,if=remains<4.5&active_enemies>1
actions+=/call_action_list,name=finisher,if=combo_points=5
actions+=/call_action_list,name=maintain
actions+=/call_action_list,name=generator,if=combo_points<5

actions.finisher=ferocious_bite,cycle_targets=1,max_energy=1,if=target.health.pct<25&dot.rip.ticking
actions.finisher+=/rip,cycle_targets=1,if=remains<3&target.time_to_die-remains>18
actions.finisher+=/rip,cycle_targets=1,if=remains<7.2&persistent_multiplier>dot.rip.pmultiplier&target.time_to_die-remains>18
actions.finisher+=/savage_roar,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)&buff.savage_roar.remains<12.6
actions.finisher+=/ferocious_bite,max_energy=1,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)

actions.maintain=rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<3&combo_points<5&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<4.5&combo_points<5&persistent_multiplier>dot.rake.pmultiplier&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/rake,cycle_targets=1,if=talent.bloodtalons.enabled&remains<4.5&combo_points<5&(!buff.predatory_swiftness.up|buff.bloodtalons.up|persistent_multiplier>dot.rake.pmultiplier)&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/thrash_cat,cycle_targets=1,if=talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
actions.maintain+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<4.2&active_enemies<6&target.time_to_die-remains>tick_time*5
actions.maintain+=/rake,cycle_targets=1,if=persistent_multiplier>dot.rake.pmultiplier&combo_points<5&active_enemies=1

actions.generator=swipe,if=active_enemies>=3
actions.generator+=/shred,if=active_enemies<3

head=crown_of_woe,id=118941
neck=mordant_gorget,id=119011,bonus_id=202/560,enchant=40crit
shoulders=bloodfeather_spaulders,id=109935,bonus_id=524
back=rotmelter_mosscloak,id=116294
chest=crystalbinder_chestguard,id=109886,bonus_id=42/524
shirt=undisputed_champions_shirt,id=98082
wrists=bloodfeather_bracers,id=109869,bonus_id=524
hands=bloodfeather_grips,id=109849,bonus_id=522
waist=springrain_belt,id=119513
legs=legguards_of_burning_focus,id=109809,bonus_id=524
feet=boots_of_determined_resolve,id=114502,bonus_id=30
finger1=timeless_solium_band_of_the_assassin,id=118297,enchant=30crit
finger2=ceds_chiming_circle,id=109760,bonus_id=523/524,gems=35crit
trinket1=bloodmaws_tooth,id=116289
trinket2=grandiose_plans,id=114549
main_hand=chasmwrench_docking_hook,id=110059,bonus_id=524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_agility=2076
# gear_stamina=2578
# gear_crit_rating=1038
# gear_haste_rating=818
# gear_mastery_rating=313
# gear_armor=816
# gear_multistrike_rating=183
# gear_versatility_rating=346
# gear_speed_rating=95

Rapáx

Rapáx : 23128 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
23127.7 23127.7 4.6 / 0.020% 1456.5 / 6.3% 1712.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Focus 0.00% 46.9 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Rapáx/advanced
Talents
  • 15: Posthaste
  • 30: Binding Shot
  • 45: Spirit Bond
  • 60: Thrill of the Hunt
  • 75: A Murder of Crows
  • 90: Barrage
  • 100: Focusing Shot (Survival Hunter)
  • Talent Calculator
Glyphs
  • Glyph of Liberation
  • Glyph of Pathfinding
  • Glyph of Animal Bond
  • Glyph of Aspect of the Pack
  • Glyph of Aspect of the Cheetah
  • Glyph of Tame Beast
Professions
  • leatherworking: 700
  • skinning: 700

Charts

http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Rap%C3%A1x+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:87683|59660|20802|18440|10955|4026|2108&chds=0,175366&chco=C79C6E,9482C9,C79C6E,C41F3B,69CCF0,C79C6E,C79C6E&chm=t++87683++a_murder_of_crows,C79C6E,0,0,15|t++59660++black_arrow,9482C9,1,0,15|t++20802++barrage,C79C6E,2,0,15|t++18440++explosive_shot,C41F3B,3,0,15|t++10955++arcane_shot,69CCF0,4,0,15|t++4026++focusing_shot,C79C6E,5,0,15|t++2108++auto_shot,C79C6E,6,0,15& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rap%C3%A1x+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:22,18,16,12,10,9,8,7,6,3&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,69CCF0,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=explosive_shot|serpent_sting|arcane_shot|black_arrow|barrage|auto_shot|cat: melee|crow_peck|focusing_shot|cat: claw&
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Rap%C3%A1x+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:aehmosvz14578753211ywutqqommlklkkkkkllkkkjjjiihggfffeefffggghijjkkllkllllkkkkjjkjjjijjiiiiiihihgggggffffffgffgghhhiiijjjkkklmmnoppqrsttuvuvvuvuttrqponmlkjjihhgghghhghhhhhhhhggggggfggfggghhhjjjkkklllllkkkkkkjjjiiihiihiihihhhhhhggggfgggggghhhiiijjjkkkllllllmmmnnmnnnonnnnmmmllkjjjiihhhggggggggghhhhghhghhghgggggggghhhijjjkkllkllkllkkkjkjiiiiiiiiihhihhihihghhgggggfeecbZYWUTRPO&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.616765,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=23128|max=37498&chxp=1,1,62,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Rap%C3%A1x+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,1,9,5,17,34,42,75,119,207,272,368,460,608,712,850,1042,1160,1247,1361,1411,1500,1451,1463,1479,1283,1228,1126,949,907,705,648,527,411,328,262,207,172,118,64,54,36,21,21,15,11,7,1,0,3&chds=0,1500&chbh=5&chxt=x&chxl=0:|min=21848|avg=23128|max=24646&chxp=0,1,46,100& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rap%C3%A1x+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:30.0,29.3,24.7,10.1,4.1,1.7&chds=0,100&chdls=ffffff&chco=C79C6E,69CCF0,C41F3B,C79C6E,9482C9,C79C6E&chl=focusing_shot 90.4s|arcane_shot 88.2s|explosive_shot 74.3s|barrage 30.4s|black_arrow 12.3s|a_murder_of_crows 5.2s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Rapáx 23128
a_murder_of_crows 0 (1529) 0.0% (6.6%) 5.2 63.19sec 88075 87683

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.22 5.22 76.34 76.34 1.0045 1.0000 0.00 0.00 0.00 5631.28 87683.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.3 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 1529 6.6% 0.0 0.00sec 0 0 Direct 76.3 4021 8231 5650 38.7% 16.5 1206 2469 38.8%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 76.34 0.00 0.00 0.0000 0.0000 459371.55 705981.54 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.42 38.78% 2469.22 2218 2796 2466.82 0 2796 15843 24349 34.85
multistrike 10.13 61.22% 1206.39 1109 1398 1207.89 0 1398 12221 18782 34.93
hit 46.80 61.31% 4021.17 3696 4660 4026.30 3738 4310 188199 289232 34.93
crit 29.53 38.69% 8231.38 7392 9320 8244.67 7484 9172 243108 373619 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 3217 13.9% 87.9 3.40sec 11005 10955 Direct 87.5 7514 15170 10252 35.8% 18.9 2705 5461 35.7%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.85 87.50 0.00 0.00 1.0045 0.0000 966772.04 966772.04 0.00 10955.30 10955.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.75 35.68% 5461.47 5270 6323 5458.33 0 6323 36858 36858 0.00
multistrike 12.17 64.32% 2705.14 2635 3162 2706.48 2635 3162 32914 32914 0.00
hit 56.21 64.24% 7514.40 7319 8782 7517.64 7319 7819 422390 422390 0.00
crit 31.29 35.76% 15169.62 14639 17564 15178.63 14639 16178 474610 474610 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 1872 8.1% 106.7 2.83sec 5272 2108 Direct 106.7 3582 7239 4891 35.8% 23.1 1289 2606 35.7%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.68 106.68 0.00 0.00 2.5013 0.0000 562385.94 864298.39 34.93 2107.57 2107.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.24 35.75% 2605.86 2505 3014 2606.84 0 3014 21484 33018 34.92
multistrike 14.82 64.25% 1289.43 1253 1507 1290.05 1253 1507 19109 29367 34.93
hit 68.48 64.19% 3581.72 3480 4186 3583.32 3480 3725 245289 376970 34.93
crit 38.20 35.81% 7238.89 6959 8372 7243.62 6991 7665 276504 424943 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
barrage 2107 9.1% 11.1 27.18sec 57311 20802 Periodic 176.4 2343 4746 3205 35.9% 38.3 1296 2626 35.9% 9.2%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.05 11.05 176.82 176.44 2.7551 0.1566 633346.80 936925.20 32.40 20802.30 20802.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.7 35.86% 2625.66 2519 3022 2627.74 2519 3022 36033 36033 0.00
multistrike 24.6 64.14% 1296.32 1259 1511 1297.08 1259 1427 31825 31825 0.00
hit 113.2 64.13% 2343.19 2276 2731 2344.48 2276 2432 265136 407471 34.93
crit 63.3 35.87% 4745.90 4553 5463 4749.43 4553 5030 300354 461596 34.93
 
DPS Timeline Chart
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.69
 
black_arrow 2437 10.5% 12.2 25.74sec 59928 59660 Periodic 117.5 4231 8575 5784 35.7% 25.4 1523 3087 35.8% 78.1%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.22 12.18 117.50 117.50 1.0045 2.0000 732508.26 732508.26 0.00 2962.24 59660.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.95 65.21% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.24 34.79% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.1 35.77% 3087.35 2939 3706 3089.47 0 3706 28063 28063 0.00
multistrike 16.3 64.23% 1523.31 1470 1853 1524.29 1470 1738 24860 24860 0.00
hit 75.5 64.26% 4230.93 4083 5147 4233.50 4110 4392 319453 319453 0.00
crit 42.0 35.74% 8574.96 8165 10295 8582.21 8216 9120 360132 360132 0.00
 
DPS Timeline Chart
 

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.566720
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
explosive_shot 4556 19.7% 74.0 4.07sec 18523 18440 Direct 73.7 3174 6428 4336 35.7% 16.0 1143 2315 35.6%  
Periodic 169.1 4118 8327 5626 35.8% 36.6 1482 3000 35.7% 56.2%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.95 73.71 169.08 169.08 1.0045 1.0000 1369768.60 1369768.60 0.00 5628.52 18439.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.69 35.64% 2314.70 2205 2780 2307.80 0 2780 13176 13176 0.00
multistrike 10.28 64.36% 1142.58 1102 1390 1143.18 1102 1390 11747 11747 0.00
hit 47.39 64.29% 3173.77 3062 3861 3175.63 3062 3368 150409 150409 0.00
crit 26.32 35.71% 6428.38 6124 7721 6433.79 6124 7122 169184 169184 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.1 35.72% 2999.88 2205 8134 2999.56 2205 5063 39185 39185 0.00
multistrike 23.5 64.28% 1482.17 1102 4013 1482.35 1134 2085 34835 34835 0.00
hit 108.5 64.17% 4117.61 3062 11297 4117.99 3658 5208 446745 446745 0.00
crit 60.6 35.83% 8327.13 6124 22593 8328.70 7023 10958 504486 504486 0.00
 
DPS Timeline Chart
 

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.552552
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
focusing_shot 1210 5.2% 42.6 6.96sec 8541 4026 Direct 42.6 5825 11756 7928 35.5% 9.2 2098 4233 35.5%  

Stats details: focusing_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.61 42.58 0.00 0.00 2.1213 0.0000 363895.37 559249.73 34.93 4026.10 4026.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.27 35.46% 4232.56 4097 4916 4066.93 0 4916 13844 21276 33.54
multistrike 5.95 64.54% 2097.73 2049 2458 2091.41 0 2458 12490 19196 34.81
hit 27.48 64.54% 5825.34 5691 6828 5827.41 5691 6128 160068 245999 34.93
crit 15.10 35.46% 11755.67 11382 13656 11763.82 11382 12829 177493 272779 34.93
 
DPS Timeline Chart
 

Action details: focusing_shot

Static Values
  • id:152245
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:180.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152245
  • name:Focusing Shot
  • school:physical
  • tooltip:
  • description:Carefully line up a shot at the target that deals $sw1 Physical damage and focuses you, generating {$s2=50} Focus. Cannot be cast while moving. Replaces Steady Shot and Cobra Shot.$?s53224[ Also triggers Steady Focus.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
serpent_sting 3766 16.3% 87.5 3.40sec 12942 0 Periodic 185.8 4146 8385 5654 35.6% 40.1 1493 3019 35.5% 98.0%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.50 87.50 185.83 185.83 0.0000 1.5875 1132374.95 1132374.95 0.00 3838.44 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.25 64.29% 0.00 0 0 0.00 0 0 0 0 0.00
crit 31.25 35.71% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 14.3 35.50% 3019.08 2893 3648 3020.94 2893 3497 43028 43028 0.00
multistrike 25.9 64.50% 1492.51 1447 1824 1493.36 1447 1698 38641 38641 0.00
hit 119.7 64.42% 4145.72 3 5067 4147.94 4054 4301 496288 496288 0.00
crit 66.1 35.58% 8384.60 59 10133 8390.76 8096 8857 554418 554418 0.00
 
DPS Timeline Chart
 

Action details: serpent_sting

Static Values
  • id:118253
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118253
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes $o1 Nature damage over {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.725402
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - cat 2435 / 2435
claw 712 3.1% 73.0 4.17sec 2927 2914 Direct 73.0 1859 3792 2748 46.0% 15.8 557 1138 46.1%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.98 72.98 0.00 0.00 1.0045 0.0000 213605.97 328278.65 34.93 2913.86 2913.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.30 46.13% 1137.85 1042 2628 1138.55 0 2628 8302 12759 34.91
multistrike 8.52 53.87% 557.31 521 1314 557.62 0 1314 4749 7298 34.92
hit 39.41 54.01% 1859.00 1737 4381 1860.76 1737 2069 73271 112605 34.93
crit 33.57 45.99% 3792.13 3474 8762 3797.27 3474 4366 127285 195616 34.93
 
DPS Timeline Chart
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 1723 7.4% 196.5 1.53sec 2635 1725 Direct 196.5 1683 3409 2475 45.9% 42.4 505 1022 46.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.49 196.49 0.00 0.00 1.5274 0.0000 517779.05 795744.64 34.93 1725.33 1725.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 19.51 46.02% 1022.44 975 1229 1023.17 975 1144 19951 30662 34.93
multistrike 22.89 53.98% 504.72 487 614 505.01 487 567 11555 17758 34.93
hit 106.31 54.10% 1682.71 1624 2048 1683.65 1636 1746 178885 274918 34.93
crit 90.18 45.90% 3408.65 3249 4096 3411.24 3308 3556 307388 472407 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Rapáx
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_pet

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 42.86% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 155.0sec 0.0sec 15.18% 15.19% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lock_and_load 14.5 0.2 20.5sec 20.2sec 7.88% 39.16% 0.2(0.2)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lock_and_load_1:4.86%
  • lock_and_load_2:3.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:168980
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown.
  • description:{$@spelldesc3674=Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
megawatt_filament 7.2 2.4 43.9sec 31.5sec 32.79% 32.80% 2.4(2.4)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_megawatt_filament
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:750.00

Stack Uptimes

  • megawatt_filament_1:32.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156060
  • name:Megawatt Filament
  • tooltip:Critical strike increased by $w1.
  • description:Critical strike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.0 0.0 120.3sec 120.3sec 19.15% 19.16% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
thrill_of_the_hunt 16.4 4.4 18.0sec 14.1sec 30.73% 60.89% 4.4(8.3)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • thrill_of_the_hunt_1:10.63%
  • thrill_of_the_hunt_2:11.28%
  • thrill_of_the_hunt_3:8.83%

Trigger Attempt Success

  • trigger_pct:13.31%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot, Aimed Shot, or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a {$s1=6}% chance per 10 Focus spent on Focus-costing attacks to trigger Thrill of the Hunt. Thrill of the Hunt reduces the Focus cost of your next {$s2=3} Arcane Shots, Aimed Shots, or Multi-Shots by {$34720s1=20}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rapáx
a_murder_of_crows Focus 5.2 156.5 30.0 30.0 2935.9
arcane_shot Focus 87.9 1710.8 19.5 19.5 565.1
barrage Focus 11.1 663.1 60.0 60.0 955.2
black_arrow Focus 12.2 427.8 35.0 35.0 1712.2
explosive_shot Focus 74.0 673.3 9.1 9.1 2034.3
pet - cat
claw Focus 73.0 1874.5 25.7 25.7 114.0
Resource Gains Type Count Total Average Overflow
focus_regen Focus 232.22 1428.82 (30.84%) 6.15 0.27 0.02%
external_healing Health 8.90 0.00 (0.00%) 0.00 82221.32 100.00%
thrill_of_the_hunt_savings Focus 53.72 1074.34 (23.19%) 20.00 0.00 0.00%
focusing_shot Focus 42.61 2130.38 (45.98%) 50.00 0.00 0.00%
pet - cat
focus_regen Focus 300.41 1786.94 (100.00%) 5.95 0.00 0.00%
Resource RPS-Gain RPS-Loss
Focus 11.83 12.07
Combat End Resource Mean Min Max
Focus 27.90 0.01 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.0%
cat-Focus Cap 0.0%
devilsaur-Focus Cap 0.0%
raptor-Focus Cap 0.0%
hyena-Focus Cap 0.0%
wolf-Focus Cap 0.0%
wasp-Focus Cap 0.0%
t17_pet_2-Focus Cap 0.0%
t17_pet_1-Focus Cap 0.0%
dire_beast_1-Focus Cap 0.0%
dire_beast_2-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%

Procs

Count Interval
starved: black_arrow 6.2 31.1sec
starved: explosive_shot 4.0 48.1sec
starved: a_murder_of_crows 3.2 36.5sec
starved: barrage 27.1 10.7sec
thrill_of_the_hunt 20.8 14.1sec
lock_and_load 14.7 20.2sec

Statistics & Data Analysis

Fight Length
Sample Data Rapáx Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Rapáx Damage Per Second
Count 25000
Mean 23127.67
Minimum 21847.67
Maximum 24645.53
Spread ( max - min ) 2797.86
Range [ ( max - min ) / 2 * 100% ] 6.05%
Standard Deviation 372.5285
5th Percentile 22531.41
95th Percentile 23761.95
( 95th Percentile - 5th Percentile ) 1230.54
Mean Distribution
Standard Deviation 2.3561
95.00% Confidence Intervall ( 23123.05 - 23132.29 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9
0.1% Error 996
0.1 Scale Factor Error with Delta=300 1184
0.05 Scale Factor Error with Delta=300 4738
0.01 Scale Factor Error with Delta=300 118468
Distribution Chart
DPS(e)
Sample Data Rapáx Damage Per Second (Effective)
Count 25000
Mean 23127.67
Minimum 21847.67
Maximum 24645.53
Spread ( max - min ) 2797.86
Range [ ( max - min ) / 2 * 100% ] 6.05%
Damage
Sample Data Rapáx Damage
Count 25000
Mean 6220423.52
Minimum 4692508.13
Maximum 7841498.91
Spread ( max - min ) 3148990.77
Range [ ( max - min ) / 2 * 100% ] 25.31%
DTPS
Sample Data Rapáx Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rapáx Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Rapáx Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rapáx Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rapáx Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rapáx Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RapáxTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Rapáx Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 arcane_torrent,if=focus.deficit>=30
9 0.00 blood_fury
A 0.00 berserking
B 1.00 potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
C 0.00 call_action_list,name=aoe,if=active_enemies>1
D 0.00 stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
E 12.22 black_arrow,if=!ticking
F 73.95 explosive_shot
G 5.22 a_murder_of_crows
H 0.00 dire_beast
I 20.78 arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
J 0.00 glaive_toss
K 0.00 powershot
L 11.05 barrage
M 0.00 cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Cast a second shot for steady focus if that won't cap us.
N 67.07 arcane_shot,if=focus>=80|talent.focusing_shot.enabled
O 42.93 focusing_shot
P 0.00 cobra_shot

Sample Sequence

01267EFGIOLFNNFFFNONNNFOIIENFOLFFFNONNOFNNONFNOENFOLFFFNNNOFGNONFNOENFOLFNNNOFFFFIFFFIIEOFNNNOFLOFNFFFIIINOBEFOGFFFNNOLFOIIIFNNNOEFONLNOFFFFFIINNOFFEFNOLFONGOFNNONFFFENNNOFLNNOFFFFINONFENNOFINOLFFFNONNFOEGOFFFLNNNOFNNONFNOEIFNOLFFFNIIOF

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre summon_pet Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 black_arrow Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:01.005 explosive_shot Fluffy_Pillow 71.0/100: 71% focus bloodlust, megawatt_filament, draenic_agility_potion
0:02.009 a_murder_of_crows Fluffy_Pillow 62.0/100: 62% focus bloodlust, megawatt_filament, draenic_agility_potion
0:03.014 arcane_shot Fluffy_Pillow 37.9/100: 38% focus bloodlust, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:04.020 focusing_shot Fluffy_Pillow 13.9/100: 14% focus bloodlust, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:05.707 barrage Fluffy_Pillow 73.9/100: 74% focus bloodlust, thrill_of_the_hunt(3), spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:08.007 explosive_shot Fluffy_Pillow 27.6/100: 28% focus bloodlust, thrill_of_the_hunt(3), spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:09.013 arcane_shot Fluffy_Pillow 18.6/100: 19% focus bloodlust, thrill_of_the_hunt(3), spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:10.019 arcane_shot Fluffy_Pillow 14.6/100: 15% focus bloodlust, thrill_of_the_hunt(2), spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:11.023 explosive_shot Fluffy_Pillow 10.6/100: 11% focus bloodlust, thrill_of_the_hunt, lock_and_load(2), spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:12.029 explosive_shot Fluffy_Pillow 16.6/100: 17% focus bloodlust, thrill_of_the_hunt, lock_and_load, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:13.033 explosive_shot Fluffy_Pillow 22.5/100: 23% focus bloodlust, thrill_of_the_hunt, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:14.037 arcane_shot Fluffy_Pillow 13.5/100: 14% focus bloodlust, thrill_of_the_hunt, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:15.041 focusing_shot Fluffy_Pillow 9.5/100: 9% focus bloodlust, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:16.727 arcane_shot Fluffy_Pillow 69.5/100: 70% focus bloodlust, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:17.731 arcane_shot Fluffy_Pillow 45.5/100: 45% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:18.735 arcane_shot Fluffy_Pillow 21.4/100: 21% focus bloodlust, thrill_of_the_hunt(2), spirit_of_the_warlords, draenic_agility_potion
0:19.739 explosive_shot Fluffy_Pillow 17.4/100: 17% focus bloodlust, thrill_of_the_hunt, spirit_of_the_warlords, draenic_agility_potion
0:20.743 focusing_shot Fluffy_Pillow 8.4/100: 8% focus bloodlust, thrill_of_the_hunt(3), spirit_of_the_warlords
0:22.428 arcane_shot Fluffy_Pillow 68.4/100: 68% focus bloodlust, thrill_of_the_hunt(3), spirit_of_the_warlords
0:23.431 arcane_shot Fluffy_Pillow 64.4/100: 64% focus bloodlust, thrill_of_the_hunt(2)
0:24.437 black_arrow Fluffy_Pillow 60.4/100: 60% focus bloodlust, thrill_of_the_hunt
0:25.441 arcane_shot Fluffy_Pillow 31.3/100: 31% focus bloodlust, thrill_of_the_hunt
0:26.447 explosive_shot Fluffy_Pillow 27.3/100: 27% focus bloodlust
0:27.453 focusing_shot Fluffy_Pillow 18.3/100: 18% focus bloodlust
0:29.138 barrage Fluffy_Pillow 78.3/100: 78% focus bloodlust
0:31.374 explosive_shot Fluffy_Pillow 31.6/100: 32% focus bloodlust, lock_and_load(2)
0:32.376 explosive_shot Fluffy_Pillow 37.6/100: 38% focus bloodlust, lock_and_load
0:33.381 explosive_shot Fluffy_Pillow 43.6/100: 44% focus bloodlust
0:34.386 arcane_shot Fluffy_Pillow 34.5/100: 35% focus bloodlust
0:35.389 focusing_shot Fluffy_Pillow 10.5/100: 11% focus bloodlust
0:37.075 arcane_shot Fluffy_Pillow 70.5/100: 71% focus bloodlust
0:38.079 arcane_shot Fluffy_Pillow 46.5/100: 47% focus bloodlust
0:39.086 focusing_shot Fluffy_Pillow 22.5/100: 23% focus bloodlust
0:40.770 explosive_shot Fluffy_Pillow 82.5/100: 83% focus bloodlust
0:41.775 arcane_shot Fluffy_Pillow 72.1/100: 72% focus
0:42.779 arcane_shot Fluffy_Pillow 46.7/100: 47% focus
0:43.783 focusing_shot Fluffy_Pillow 21.3/100: 21% focus
0:45.973 arcane_shot Fluffy_Pillow 81.3/100: 81% focus
0:46.978 explosive_shot Fluffy_Pillow 55.9/100: 56% focus
0:47.983 arcane_shot Fluffy_Pillow 45.5/100: 46% focus
0:48.987 focusing_shot Fluffy_Pillow 20.1/100: 20% focus
0:51.176 black_arrow Fluffy_Pillow 80.1/100: 80% focus
0:52.179 arcane_shot Fluffy_Pillow 49.7/100: 50% focus
0:53.184 explosive_shot Fluffy_Pillow 24.3/100: 24% focus
0:54.189 focusing_shot Fluffy_Pillow 13.9/100: 14% focus
0:56.379 barrage Fluffy_Pillow 73.9/100: 74% focus thrill_of_the_hunt(3), megawatt_filament
0:59.164 explosive_shot Fluffy_Pillow 26.7/100: 27% focus thrill_of_the_hunt(3), lock_and_load(2), megawatt_filament
1:00.171 explosive_shot Fluffy_Pillow 31.3/100: 31% focus thrill_of_the_hunt(3), lock_and_load, megawatt_filament
1:01.178 explosive_shot Fluffy_Pillow 35.9/100: 36% focus thrill_of_the_hunt(3), megawatt_filament
1:02.183 arcane_shot Fluffy_Pillow 25.5/100: 26% focus thrill_of_the_hunt(3), megawatt_filament
1:03.187 arcane_shot Fluffy_Pillow 20.1/100: 20% focus thrill_of_the_hunt(2), megawatt_filament
1:04.192 arcane_shot Fluffy_Pillow 14.7/100: 15% focus thrill_of_the_hunt(2), megawatt_filament
1:05.197 focusing_shot Fluffy_Pillow 9.3/100: 9% focus thrill_of_the_hunt, megawatt_filament
1:07.387 explosive_shot Fluffy_Pillow 69.3/100: 69% focus thrill_of_the_hunt, megawatt_filament
1:08.392 a_murder_of_crows Fluffy_Pillow 58.9/100: 59% focus thrill_of_the_hunt, megawatt_filament
1:09.397 arcane_shot Fluffy_Pillow 33.5/100: 34% focus thrill_of_the_hunt, megawatt_filament
1:10.403 focusing_shot Fluffy_Pillow 28.1/100: 28% focus megawatt_filament
1:12.593 arcane_shot Fluffy_Pillow 88.1/100: 88% focus megawatt_filament
1:13.598 explosive_shot Fluffy_Pillow 62.7/100: 63% focus
1:14.602 arcane_shot Fluffy_Pillow 52.3/100: 52% focus
1:15.607 focusing_shot Fluffy_Pillow 26.9/100: 27% focus
1:17.795 black_arrow Fluffy_Pillow 86.9/100: 87% focus
1:18.799 arcane_shot Fluffy_Pillow 56.5/100: 57% focus
1:19.803 explosive_shot Fluffy_Pillow 31.1/100: 31% focus
1:20.808 focusing_shot Fluffy_Pillow 20.7/100: 21% focus
1:22.996 barrage Fluffy_Pillow 80.7/100: 81% focus thrill_of_the_hunt(3)
1:25.874 explosive_shot Fluffy_Pillow 33.9/100: 34% focus thrill_of_the_hunt(3)
1:26.877 arcane_shot Fluffy_Pillow 23.5/100: 24% focus thrill_of_the_hunt(3)
1:27.882 arcane_shot Fluffy_Pillow 18.1/100: 18% focus thrill_of_the_hunt(2)
1:28.884 arcane_shot Fluffy_Pillow 12.7/100: 13% focus thrill_of_the_hunt
1:29.889 focusing_shot Fluffy_Pillow 7.3/100: 7% focus
1:32.078 explosive_shot Fluffy_Pillow 67.3/100: 67% focus
1:33.081 explosive_shot Fluffy_Pillow 56.9/100: 57% focus thrill_of_the_hunt(3), lock_and_load(2)
1:34.087 explosive_shot Fluffy_Pillow 61.5/100: 61% focus thrill_of_the_hunt(3), lock_and_load
1:35.093 explosive_shot Fluffy_Pillow 66.1/100: 66% focus thrill_of_the_hunt(3)
1:36.099 arcane_shot Fluffy_Pillow 55.7/100: 56% focus thrill_of_the_hunt(3)
1:37.103 explosive_shot Fluffy_Pillow 50.3/100: 50% focus thrill_of_the_hunt(2), lock_and_load(2)
1:38.108 explosive_shot Fluffy_Pillow 54.9/100: 55% focus thrill_of_the_hunt(2), lock_and_load
1:39.114 explosive_shot Fluffy_Pillow 59.5/100: 59% focus thrill_of_the_hunt(2)
1:40.118 arcane_shot Fluffy_Pillow 49.1/100: 49% focus thrill_of_the_hunt(2)
1:41.122 arcane_shot Fluffy_Pillow 43.7/100: 44% focus thrill_of_the_hunt
1:42.127 black_arrow Fluffy_Pillow 38.3/100: 38% focus
1:43.131 focusing_shot Fluffy_Pillow 7.9/100: 8% focus
1:45.322 explosive_shot Fluffy_Pillow 67.9/100: 68% focus
1:46.326 arcane_shot Fluffy_Pillow 57.5/100: 57% focus
1:47.330 arcane_shot Fluffy_Pillow 32.1/100: 32% focus thrill_of_the_hunt(2)
1:48.336 arcane_shot Fluffy_Pillow 26.7/100: 27% focus thrill_of_the_hunt
1:49.339 focusing_shot Fluffy_Pillow 21.3/100: 21% focus
1:51.530 explosive_shot Fluffy_Pillow 81.3/100: 81% focus
1:52.536 barrage Fluffy_Pillow 70.9/100: 71% focus
1:55.450 focusing_shot Fluffy_Pillow 24.2/100: 24% focus
1:57.640 explosive_shot Fluffy_Pillow 84.3/100: 84% focus
1:58.644 arcane_shot Fluffy_Pillow 73.9/100: 74% focus
1:59.648 explosive_shot Fluffy_Pillow 48.5/100: 48% focus lock_and_load(2)
2:00.652 explosive_shot Fluffy_Pillow 53.1/100: 53% focus lock_and_load
2:01.657 explosive_shot Fluffy_Pillow 57.7/100: 58% focus
2:02.661 arcane_shot Fluffy_Pillow 47.2/100: 47% focus thrill_of_the_hunt(3), spirit_of_the_warlords
2:03.668 arcane_shot Fluffy_Pillow 41.9/100: 42% focus thrill_of_the_hunt(2), spirit_of_the_warlords
2:04.672 arcane_shot Fluffy_Pillow 36.4/100: 36% focus thrill_of_the_hunt, spirit_of_the_warlords
2:05.676 arcane_shot Fluffy_Pillow 31.0/100: 31% focus spirit_of_the_warlords
2:06.679 focusing_shot Fluffy_Pillow 5.6/100: 6% focus spirit_of_the_warlords
2:08.868 potion Fluffy_Pillow 65.6/100: 66% focus spirit_of_the_warlords
2:08.868 black_arrow Fluffy_Pillow 65.6/100: 66% focus spirit_of_the_warlords, draenic_agility_potion
2:09.873 explosive_shot Fluffy_Pillow 35.2/100: 35% focus spirit_of_the_warlords, draenic_agility_potion
2:10.877 focusing_shot Fluffy_Pillow 24.8/100: 25% focus spirit_of_the_warlords, draenic_agility_potion
2:13.068 a_murder_of_crows Fluffy_Pillow 84.9/100: 85% focus spirit_of_the_warlords, draenic_agility_potion
2:14.073 explosive_shot Fluffy_Pillow 59.5/100: 59% focus lock_and_load(2), spirit_of_the_warlords, draenic_agility_potion
2:15.077 explosive_shot Fluffy_Pillow 64.1/100: 64% focus lock_and_load, spirit_of_the_warlords, draenic_agility_potion
2:16.081 explosive_shot Fluffy_Pillow 68.7/100: 69% focus spirit_of_the_warlords, draenic_agility_potion
2:17.086 arcane_shot Fluffy_Pillow 58.3/100: 58% focus spirit_of_the_warlords, draenic_agility_potion
2:18.090 arcane_shot Fluffy_Pillow 32.8/100: 33% focus spirit_of_the_warlords, draenic_agility_potion
2:19.095 focusing_shot Fluffy_Pillow 7.4/100: 7% focus spirit_of_the_warlords, draenic_agility_potion
2:21.285 barrage Fluffy_Pillow 67.5/100: 67% focus thrill_of_the_hunt(3), spirit_of_the_warlords, draenic_agility_potion
2:24.078 explosive_shot Fluffy_Pillow 20.2/100: 20% focus thrill_of_the_hunt(3), draenic_agility_potion
2:25.083 focusing_shot Fluffy_Pillow 9.8/100: 10% focus thrill_of_the_hunt(3), draenic_agility_potion
2:27.274 arcane_shot Fluffy_Pillow 69.9/100: 70% focus thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
2:28.278 arcane_shot Fluffy_Pillow 64.5/100: 64% focus thrill_of_the_hunt(2), megawatt_filament, draenic_agility_potion
2:29.283 arcane_shot Fluffy_Pillow 59.1/100: 59% focus thrill_of_the_hunt, megawatt_filament, draenic_agility_potion
2:30.287 explosive_shot Fluffy_Pillow 53.7/100: 54% focus megawatt_filament, draenic_agility_potion
2:31.293 arcane_shot Fluffy_Pillow 43.3/100: 43% focus megawatt_filament, draenic_agility_potion
2:32.297 arcane_shot Fluffy_Pillow 17.9/100: 18% focus thrill_of_the_hunt(2), megawatt_filament, draenic_agility_potion
2:33.301 arcane_shot Fluffy_Pillow 12.4/100: 12% focus thrill_of_the_hunt, megawatt_filament, draenic_agility_potion
2:34.305 focusing_shot Fluffy_Pillow 7.0/100: 7% focus megawatt_filament
2:36.495 black_arrow Fluffy_Pillow 67.1/100: 67% focus megawatt_filament
2:37.501 explosive_shot Fluffy_Pillow 36.7/100: 37% focus megawatt_filament
2:38.508 focusing_shot Fluffy_Pillow 26.3/100: 26% focus megawatt_filament
2:40.699 arcane_shot Fluffy_Pillow 86.3/100: 86% focus
2:41.703 barrage Fluffy_Pillow 60.9/100: 61% focus thrill_of_the_hunt(3)
2:44.586 arcane_shot Fluffy_Pillow 14.1/100: 14% focus thrill_of_the_hunt(3)
2:45.592 focusing_shot Fluffy_Pillow 8.7/100: 9% focus thrill_of_the_hunt(2)
2:47.779 explosive_shot Fluffy_Pillow 68.7/100: 69% focus thrill_of_the_hunt(2), lock_and_load(2)
2:48.784 explosive_shot Fluffy_Pillow 73.3/100: 73% focus thrill_of_the_hunt(2), lock_and_load
2:49.789 explosive_shot Fluffy_Pillow 77.9/100: 78% focus thrill_of_the_hunt(2), lock_and_load(2)
2:50.795 explosive_shot Fluffy_Pillow 82.5/100: 82% focus thrill_of_the_hunt(2), lock_and_load
2:51.801 explosive_shot Fluffy_Pillow 87.1/100: 87% focus thrill_of_the_hunt(2)
2:52.808 arcane_shot Fluffy_Pillow 76.7/100: 77% focus thrill_of_the_hunt(2)
2:53.814 arcane_shot Fluffy_Pillow 71.3/100: 71% focus thrill_of_the_hunt
2:54.819 arcane_shot Fluffy_Pillow 65.9/100: 66% focus
2:55.822 arcane_shot Fluffy_Pillow 40.5/100: 41% focus
2:56.825 focusing_shot Fluffy_Pillow 15.1/100: 15% focus
2:59.015 explosive_shot Fluffy_Pillow 75.1/100: 75% focus lock_and_load(2)
3:00.020 explosive_shot Fluffy_Pillow 79.7/100: 80% focus lock_and_load
3:01.024 black_arrow Fluffy_Pillow 84.3/100: 84% focus
3:02.029 explosive_shot Fluffy_Pillow 53.9/100: 54% focus
3:03.034 arcane_shot Fluffy_Pillow 43.5/100: 44% focus
3:04.038 focusing_shot Fluffy_Pillow 18.1/100: 18% focus
3:06.228 barrage Fluffy_Pillow 78.1/100: 78% focus
3:09.063 explosive_shot Fluffy_Pillow 31.1/100: 31% focus
3:10.068 focusing_shot Fluffy_Pillow 20.7/100: 21% focus
3:12.258 arcane_shot Fluffy_Pillow 80.7/100: 81% focus
3:13.261 a_murder_of_crows Fluffy_Pillow 55.3/100: 55% focus
3:14.267 focusing_shot Fluffy_Pillow 29.9/100: 30% focus
3:16.456 explosive_shot Fluffy_Pillow 89.9/100: 90% focus
3:17.461 arcane_shot Fluffy_Pillow 79.5/100: 80% focus
3:18.463 arcane_shot Fluffy_Pillow 54.1/100: 54% focus
3:19.467 focusing_shot Fluffy_Pillow 28.7/100: 29% focus
3:21.656 arcane_shot Fluffy_Pillow 88.7/100: 89% focus
3:22.662 explosive_shot Fluffy_Pillow 63.3/100: 63% focus lock_and_load(2)
3:23.667 explosive_shot Fluffy_Pillow 67.9/100: 68% focus lock_and_load
3:24.672 explosive_shot Fluffy_Pillow 72.5/100: 73% focus
3:25.676 black_arrow Fluffy_Pillow 62.1/100: 62% focus
3:26.681 arcane_shot Fluffy_Pillow 31.7/100: 32% focus thrill_of_the_hunt(3)
3:27.685 arcane_shot Fluffy_Pillow 26.3/100: 26% focus thrill_of_the_hunt(2)
3:28.689 arcane_shot Fluffy_Pillow 20.9/100: 21% focus thrill_of_the_hunt
3:29.695 focusing_shot Fluffy_Pillow 15.5/100: 15% focus
3:31.884 explosive_shot Fluffy_Pillow 75.5/100: 76% focus
3:32.889 barrage Fluffy_Pillow 65.1/100: 65% focus thrill_of_the_hunt(3)
3:35.722 arcane_shot Fluffy_Pillow 18.1/100: 18% focus thrill_of_the_hunt(3)
3:36.725 arcane_shot Fluffy_Pillow 12.7/100: 13% focus thrill_of_the_hunt(2)
3:37.729 focusing_shot Fluffy_Pillow 7.3/100: 7% focus thrill_of_the_hunt
3:39.918 explosive_shot Fluffy_Pillow 67.3/100: 67% focus thrill_of_the_hunt
3:40.922 explosive_shot Fluffy_Pillow 56.9/100: 57% focus thrill_of_the_hunt, lock_and_load(2)
3:41.927 explosive_shot Fluffy_Pillow 61.5/100: 61% focus thrill_of_the_hunt, lock_and_load
3:42.933 explosive_shot Fluffy_Pillow 66.1/100: 66% focus thrill_of_the_hunt
3:43.938 arcane_shot Fluffy_Pillow 55.7/100: 56% focus thrill_of_the_hunt
3:44.944 arcane_shot Fluffy_Pillow 50.3/100: 50% focus
3:45.947 focusing_shot Fluffy_Pillow 24.9/100: 25% focus
3:48.137 arcane_shot Fluffy_Pillow 84.9/100: 85% focus
3:49.142 explosive_shot Fluffy_Pillow 59.5/100: 59% focus
3:50.146 black_arrow Fluffy_Pillow 49.1/100: 49% focus
3:51.150 arcane_shot Fluffy_Pillow 18.7/100: 19% focus thrill_of_the_hunt(3)
3:52.153 arcane_shot Fluffy_Pillow 13.3/100: 13% focus thrill_of_the_hunt(2), megawatt_filament
3:53.157 focusing_shot Fluffy_Pillow 7.9/100: 8% focus thrill_of_the_hunt, megawatt_filament
3:55.345 explosive_shot Fluffy_Pillow 67.9/100: 68% focus thrill_of_the_hunt, megawatt_filament
3:56.347 arcane_shot Fluffy_Pillow 57.5/100: 57% focus thrill_of_the_hunt, megawatt_filament
3:57.353 arcane_shot Fluffy_Pillow 52.1/100: 52% focus spirit_of_the_warlords, megawatt_filament
3:58.357 focusing_shot Fluffy_Pillow 26.7/100: 27% focus spirit_of_the_warlords, megawatt_filament
4:00.548 barrage Fluffy_Pillow 86.7/100: 87% focus spirit_of_the_warlords, megawatt_filament
4:03.409 explosive_shot Fluffy_Pillow 39.8/100: 40% focus lock_and_load(2), spirit_of_the_warlords, megawatt_filament
4:04.416 explosive_shot Fluffy_Pillow 44.4/100: 44% focus lock_and_load, spirit_of_the_warlords
4:05.421 explosive_shot Fluffy_Pillow 49.0/100: 49% focus spirit_of_the_warlords
4:06.425 arcane_shot Fluffy_Pillow 38.6/100: 39% focus spirit_of_the_warlords
4:07.431 focusing_shot Fluffy_Pillow 13.2/100: 13% focus spirit_of_the_warlords
4:09.620 arcane_shot Fluffy_Pillow 73.2/100: 73% focus spirit_of_the_warlords
4:10.624 arcane_shot Fluffy_Pillow 47.8/100: 48% focus spirit_of_the_warlords
4:11.629 explosive_shot Fluffy_Pillow 22.4/100: 22% focus spirit_of_the_warlords
4:12.633 focusing_shot Fluffy_Pillow 12.0/100: 12% focus spirit_of_the_warlords
4:14.823 black_arrow Fluffy_Pillow 72.0/100: 72% focus spirit_of_the_warlords
4:15.827 a_murder_of_crows Fluffy_Pillow 41.6/100: 42% focus spirit_of_the_warlords
4:16.832 focusing_shot Fluffy_Pillow 16.2/100: 16% focus
4:19.021 explosive_shot Fluffy_Pillow 76.2/100: 76% focus lock_and_load(2)
4:20.025 explosive_shot Fluffy_Pillow 80.8/100: 81% focus lock_and_load
4:21.030 explosive_shot Fluffy_Pillow 85.4/100: 85% focus
4:22.034 barrage Fluffy_Pillow 75.0/100: 75% focus thrill_of_the_hunt(3)
4:24.833 arcane_shot Fluffy_Pillow 27.8/100: 28% focus thrill_of_the_hunt(3)
4:25.837 arcane_shot Fluffy_Pillow 22.4/100: 22% focus thrill_of_the_hunt(2)
4:26.842 arcane_shot Fluffy_Pillow 17.0/100: 17% focus thrill_of_the_hunt
4:27.848 focusing_shot Fluffy_Pillow 11.6/100: 12% focus
4:30.039 explosive_shot Fluffy_Pillow 71.6/100: 72% focus
4:31.043 arcane_shot Fluffy_Pillow 61.2/100: 61% focus megawatt_filament
4:32.049 arcane_shot Fluffy_Pillow 35.8/100: 36% focus megawatt_filament
4:33.053 focusing_shot Fluffy_Pillow 10.4/100: 10% focus megawatt_filament
4:35.242 arcane_shot Fluffy_Pillow 70.4/100: 70% focus megawatt_filament
4:36.247 explosive_shot Fluffy_Pillow 45.0/100: 45% focus megawatt_filament
4:37.252 arcane_shot Fluffy_Pillow 34.6/100: 35% focus megawatt_filament
4:38.257 focusing_shot Fluffy_Pillow 9.2/100: 9% focus thrill_of_the_hunt(2), megawatt_filament
4:40.446 black_arrow Fluffy_Pillow 69.2/100: 69% focus thrill_of_the_hunt(2), megawatt_filament
4:41.451 arcane_shot Fluffy_Pillow 38.8/100: 39% focus thrill_of_the_hunt(2), megawatt_filament
4:42.455 explosive_shot Fluffy_Pillow 33.4/100: 33% focus thrill_of_the_hunt, megawatt_filament
4:43.458 arcane_shot Fluffy_Pillow 23.0/100: 23% focus thrill_of_the_hunt
4:44.461 focusing_shot Fluffy_Pillow 17.6/100: 18% focus
4:46.652 barrage Fluffy_Pillow 77.6/100: 78% focus thrill_of_the_hunt(3), megawatt_filament
4:49.498 explosive_shot Fluffy_Pillow 30.7/100: 31% focus thrill_of_the_hunt(3), lock_and_load(2), megawatt_filament
4:50.502 explosive_shot Fluffy_Pillow 35.3/100: 35% focus thrill_of_the_hunt(3), lock_and_load, megawatt_filament
4:51.507 explosive_shot Fluffy_Pillow 39.9/100: 40% focus thrill_of_the_hunt(3), megawatt_filament
4:52.512 arcane_shot Fluffy_Pillow 29.5/100: 29% focus thrill_of_the_hunt(3), megawatt_filament
4:53.517 arcane_shot Fluffy_Pillow 24.1/100: 24% focus thrill_of_the_hunt(2), megawatt_filament
4:54.520 arcane_shot Fluffy_Pillow 18.6/100: 19% focus thrill_of_the_hunt, megawatt_filament
4:55.523 focusing_shot Fluffy_Pillow 13.2/100: 13% focus megawatt_filament
4:57.713 explosive_shot Fluffy_Pillow 73.3/100: 73% focus lock_and_load(2), megawatt_filament

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 926 882 882
Agility 4227 3763 3649 (1449)
Stamina 4194 3813 3813
Intellect 896 854 854
Spirit 711 711 711
Health 251640 228780 0
Focus 100 100 0
Crit 34.05% 28.14% 1445
Haste 14.40% 8.95% 787
Multistrike 10.82% 5.82% 384
Damage / Heal Versatility 4.39% 1.39% 181
Attack Power 4650 3763 0
Mastery 14.12% 9.12% 123
Armor 1188 1188 1188

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Survival Hunter) Lone Wolf

Profile

hunter="Rapáx"
origin="http://eu.battle.net/wow/en/character/forscherliga/Rapáx/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/202/480970-avatar.jpg"
level=100
race=night_elf
role=attack
position=ranged_back
professions=skinning=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Yb!0022021
glyphs=liberation/pathfinding/animal_bond/aspect_of_the_pack/aspect_of_the_cheetah/tame_beast
spec=survival

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
actions+=/call_action_list,name=aoe,if=active_enemies>1
actions+=/stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
actions+=/black_arrow,if=!ticking
actions+=/explosive_shot
actions+=/a_murder_of_crows
actions+=/dire_beast
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
actions+=/glaive_toss
actions+=/powershot
actions+=/barrage
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
actions+=/arcane_shot,if=focus>=80|talent.focusing_shot.enabled
actions+=/focusing_shot
actions+=/cobra_shot

actions.aoe=stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up|buff.archmages_incandescence_agi.up))
actions.aoe+=/explosive_shot,if=buff.lock_and_load.react&(!talent.barrage.enabled|cooldown.barrage.remains>0)
actions.aoe+=/barrage
actions.aoe+=/black_arrow,if=!ticking
actions.aoe+=/explosive_shot,if=active_enemies<5
actions.aoe+=/explosive_trap,if=dot.explosive_trap.remains<=5
actions.aoe+=/a_murder_of_crows
actions.aoe+=/dire_beast
actions.aoe+=/multishot,if=buff.thrill_of_the_hunt.react&focus>50&cast_regen<=focus.deficit|dot.serpent_sting.remains<=5|target.time_to_die<4.5
actions.aoe+=/glaive_toss
actions.aoe+=/powershot
actions.aoe+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&focus+14+cast_regen<80
actions.aoe+=/multishot,if=focus>=70|talent.focusing_shot.enabled
actions.aoe+=/focusing_shot
actions.aoe+=/cobra_shot

head=crown_of_destruction,id=118939
neck=stormshot_choker,id=109950,bonus_id=499/524,enchant=40crit
shoulders=gruntslayer_shoulderguards,id=115414
back=cloak_of_creeping_necrosis,id=113657,enchant=gift_of_critical_strike
chest=crackleproof_chestguard,id=116029
shirt=artisan_officers_shirt,id=89195
wrists=bracers_of_the_crying_chorus,id=113826,bonus_id=40
hands=grips_of_vicious_mauling,id=113593
waist=belt_of_imminent_lies,id=113827,bonus_id=560
legs=wayfaring_leggings,id=116189,bonus_id=146/525/536
feet=wayfaring_boots,id=116193,bonus_id=131/525/535
finger1=ceds_chiming_circle,id=109760,bonus_id=524,enchant=30crit
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=30crit
trinket1=bloodmaws_tooth,id=116289
trinket2=skull_of_war,id=112318,bonus_id=525/530
main_hand=crystalline_branch_of_the_brackenspore,id=113652,enchant=megawatt_filament

# Gear Summary
# gear_agility=2297
# gear_stamina=2923
# gear_crit_rating=1445
# gear_haste_rating=787
# gear_mastery_rating=123
# gear_armor=1188
# gear_multistrike_rating=366
# gear_versatility_rating=181
# gear_avoidance_rating=68
summon_pet=cat

Rosalîîe

Rosalîîe : 23205 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
23204.5 23204.5 5.8 / 0.025% 1820.5 / 7.8% 2709.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.6 Focus 0.00% 45.8 100.0% 100%
Origin http://eu.battle.net/wow/en/character/die-nachtwache/Rosalîîe/advanced
Talents
  • 15: Posthaste
  • 30: Binding Shot
  • 45: Iron Hawk
  • 60: Thrill of the Hunt
  • 75: A Murder of Crows
  • 90: Barrage
  • 100: Lone Wolf
  • Talent Calculator
Glyphs
  • Glyph of Deterrence
  • Glyph of Black Ice
  • Glyph of Liberation
  • Glyph of Aspect of the Cheetah
Professions
  • engineering: 667
  • enchanting: 700

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:88250|82654|25461|20550|14610|5137|2716&chds=0,176499&chco=C79C6E,9482C9,C41F3B,C79C6E,69CCF0,ABD473,C79C6E&chm=t++88250++a_murder_of_crows,C79C6E,0,0,15|t++82654++black_arrow,9482C9,1,0,15|t++25461++explosive_shot,C41F3B,2,0,15|t++20550++barrage,C79C6E,3,0,15|t++14610++arcane_shot,69CCF0,4,0,15|t++5137++cobra_shot,ABD473,5,0,15|t++2716++auto_shot,C79C6E,6,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:27,15,13,10,10,10,9,7&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,ABD473,C79C6E,ABD473,C79C6E,69CCF0,C79C6E&chl=explosive_shot|black_arrow|serpent_sting|auto_shot|cobra_shot|barrage|arcane_shot|crow_peck&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:adgkmquy034787431z0ywvussqonnmmmmmmnonmmlklkkjjiihhhhhhhhijjlmlmmmnnnnnmmmmmlkllkkkkllllkkkkjjkjjjijjiiiiiiijjjkkkjjijjijjjjjjkkkllllmnnononmmmllkkjiiihhhhhhhhiiijjjjiiiiiiiiiiijjjllmopqrstuuvvwwwwwwwvuttsrqqppoonmmmllkjjiiiihhhhhhhiiijjjjjjjjjjjjjkkkkkllllmmmmnnnnmnmmmllkkkkjjjjjjjjjkjkkkkjjjjjiiiiiihiiiijjkkllmmmnnnnmnmmmmllkkkkkjkjjjjjjjjjjjijjiiiijijjjkjjkjlkihfdbZYWU&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.642176,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=23205|max=36134&chxp=1,1,64,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,2,1,1,7,16,24,40,68,132,198,307,434,627,875,1057,1251,1432,1685,1765,1794,1701,1681,1656,1548,1321,1160,908,764,668,513,376,267,198,153,138,83,44,44,25,10,6,5,4,2,2,4,0,1,1&chds=0,1794&chbh=5&chxt=x&chxl=0:|min=21400|avg=23205|max=25554&chxp=0,1,43,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:44.6,24.7,14.1,10.7,4.1,1.8&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,69CCF0,C79C6E,9482C9,C79C6E&chl=cobra_shot 134.2s|explosive_shot 74.2s|arcane_shot 42.4s|barrage 32.3s|black_arrow 12.5s|a_murder_of_crows 5.3s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Rosalîîe 23205
a_murder_of_crows 0 (1558) 0.0% (6.7%) 5.3 62.18sec 88633 88250

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 5.28 77.43 77.43 1.0045 1.0000 0.00 0.00 0.00 5655.61 88249.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.4 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 1558 6.7% 0.0 0.00sec 0 0 Direct 77.4 4299 8599 5488 27.7% 25.8 1300 2601 27.7%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 77.43 0.00 0.00 0.0000 0.0000 467899.70 719087.96 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.17 27.74% 2601.37 2347 2947 2601.48 0 2947 18654 28668 34.87
multistrike 18.68 72.26% 1299.65 1174 1474 1302.34 1174 1474 24274 37306 34.93
hit 56.01 72.33% 4298.61 3912 4912 4305.93 4057 4553 240756 370004 34.93
crit 21.42 27.67% 8599.46 7824 9824 8613.84 7824 9643 184216 283110 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 2062 8.9% 42.2 7.16sec 14676 14610 Direct 41.9 10355 20705 13228 27.8% 13.5 3749 7507 27.8%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.18 41.89 0.00 0.00 1.0045 0.0000 618958.73 618958.73 0.00 14610.14 14610.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.76 27.76% 7506.75 7119 9312 7303.65 0 9312 28214 28214 0.00
multistrike 9.78 72.24% 3749.48 3559 4656 3751.24 0 4656 36681 36681 0.00
hit 30.26 72.24% 10354.88 9887 12933 10359.08 9887 11061 313344 313344 0.00
crit 11.63 27.76% 20704.90 19774 25865 20712.94 19774 25865 240720 240720 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 2399 10.3% 108.3 2.79sec 6656 2716 Direct 108.3 4670 9337 5961 27.7% 35.0 1689 3378 27.6%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.32 108.32 0.00 0.00 2.4503 0.0000 721018.93 1108092.25 34.93 2716.46 2716.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.64 27.58% 3377.59 3253 3916 3379.70 0 3916 32556 50033 34.93
multistrike 25.31 72.42% 1688.66 1627 1958 1689.71 1627 1825 42748 65697 34.93
hit 78.35 72.33% 4669.82 4518 5439 4672.26 4576 4783 365897 562326 34.93
crit 29.97 27.67% 9337.00 9036 10878 9341.97 9036 9957 279818 430036 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
barrage 2207 9.5% 11.5 25.64sec 57558 20550 Periodic 184.1 2406 4812 3072 27.7% 57.7 1332 2665 27.7% 9.8%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.53 11.53 184.52 184.15 2.8009 0.1595 663787.71 967476.20 31.39 20550.07 20550.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.0 27.67% 2664.68 2581 3103 2666.00 2581 3037 42517 42517 0.00
multistrike 41.7 72.33% 1332.45 1290 1551 1333.21 1290 1441 55576 55576 0.00
hit 133.2 72.32% 2406.00 2332 2804 2407.41 2332 2524 320417 492431 34.93
crit 51.0 27.68% 4811.98 4664 5608 4814.74 4664 5125 245277 376952 34.93
 
DPS Timeline Chart
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.69
 
black_arrow 3426 14.8% 12.4 25.17sec 83019 82654 Periodic 119.9 6026 12052 7693 27.7% 38.5 2183 4366 27.7% 79.7%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.41 12.39 119.93 119.93 1.0045 2.0000 1030112.08 1030112.08 0.00 4082.37 82653.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.96 72.33% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.43 27.67% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.7 27.73% 4365.91 4102 5604 4369.78 0 5604 46651 46651 0.00
multistrike 27.9 72.27% 2183.16 2051 2802 2185.10 2051 2490 60802 60802 0.00
hit 86.8 72.34% 6025.85 5697 7783 6030.24 5848 6277 522773 522773 0.00
crit 33.2 27.66% 12052.38 11395 15566 12060.72 11395 13277 399886 399886 0.00
 
DPS Timeline Chart
 

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.566720
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cobra_shot 2291 9.9% 78.3 3.77sec 8807 5137 Direct 78.1 6201 12403 7914 27.6% 24.9 2243 4486 27.7%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.25 78.06 0.00 0.00 1.7144 0.0000 689151.16 689151.16 0.00 5137.02 5137.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.90 27.70% 4486.04 4271 5587 4482.70 0 5587 30942 30942 0.00
multistrike 18.00 72.30% 2243.00 2136 2793 2244.31 2136 2573 40379 40379 0.00
hit 56.49 72.37% 6200.81 5932 7760 6203.99 6001 6436 350309 350309 0.00
crit 21.57 27.63% 12402.57 11864 15519 12408.82 11864 13594 267521 267521 0.00
 
DPS Timeline Chart
 

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals $sw2 Nature damage and generates {$91954s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.76
 
explosive_shot 6284 27.1% 73.9 4.07sec 25576 25461 Direct 73.7 4530 9059 5783 27.7% 23.8 1642 3284 27.6%  
Periodic 166.5 5958 11914 7606 27.7% 53.5 2150 4296 27.7% 55.3%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.87 73.65 166.53 166.53 1.0045 1.0000 1889391.07 1889391.07 0.00 7848.49 25461.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.58 27.65% 3284.28 3077 4203 3280.93 0 4203 21609 21609 0.00
multistrike 17.22 72.35% 1642.41 1538 2101 1643.84 0 1918 28282 28282 0.00
hit 53.28 72.34% 4529.94 4273 5837 4533.39 4334 4837 241359 241359 0.00
crit 20.37 27.66% 9059.27 8546 11674 9065.52 8546 10420 184567 184567 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 14.8 27.74% 4296.17 3077 12090 4296.06 3077 6762 63765 63765 0.00
multistrike 38.7 72.26% 2150.31 1538 5884 2150.40 1686 2880 83147 83147 0.00
hit 120.4 72.32% 5958.02 4273 16792 5958.84 5352 7340 717582 717582 0.00
crit 46.1 27.68% 11913.96 8546 33584 11914.46 9951 15319 549081 549081 0.00
 
DPS Timeline Chart
 

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.552552
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
serpent_sting 2976 12.8% 41.9 7.18sec 21360 0 Periodic 139.7 4493 8985 5737 27.7% 44.6 1639 3277 27.6% 97.5%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.89 41.89 139.69 139.69 0.0000 2.1005 894709.05 894709.05 0.00 3049.23 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.30 72.34% 0.00 0 0 0.00 0 0 0 0 0.00
crit 11.59 27.66% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.3 27.64% 3277.34 3106 4243 3279.52 3106 4006 40421 40421 0.00
multistrike 32.3 72.36% 1638.77 1553 2121 1639.78 1553 1806 52921 52921 0.00
hit 101.0 72.31% 4492.52 0 5893 4495.12 4316 4680 453774 453774 0.00
crit 38.7 27.69% 8984.67 3 11786 8989.58 7897 9987 347593 347593 0.00
 
DPS Timeline Chart
 

Action details: serpent_sting

Static Values
  • id:118253
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118253
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes $o1 Nature damage over {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.725402
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Rosalîîe
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 42.86% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 186.7sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lock_and_load 14.8 0.2 20.1sec 19.8sec 8.91% 39.99% 0.2(0.2)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lock_and_load_1:4.96%
  • lock_and_load_2:3.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:168980
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown.
  • description:{$@spelldesc3674=Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
oglethorpes_missile_splitter 7.2 2.4 43.9sec 31.5sec 32.79% 32.80% 2.4(2.4)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_oglethorpes_missile_splitter
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:750.00

Stack Uptimes

  • oglethorpes_missile_splitter_1:32.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156055
  • name:Oglethorpe's Missile Splitter
  • tooltip:Multistrike increased by $w1.
  • description:Multistrike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
thrill_of_the_hunt 10.8 3.7 27.5sec 20.0sec 33.14% 79.38% 3.7(7.8)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • thrill_of_the_hunt_1:7.62%
  • thrill_of_the_hunt_2:10.64%
  • thrill_of_the_hunt_3:14.88%

Trigger Attempt Success

  • trigger_pct:13.09%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot, Aimed Shot, or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a {$s1=6}% chance per 10 Focus spent on Focus-costing attacks to trigger Thrill of the Hunt. Thrill of the Hunt reduces the Focus cost of your next {$s2=3} Arcane Shots, Aimed Shots, or Multi-Shots by {$34720s1=20}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
turbulent_vial_of_toxin 3.8 0.0 90.8sec 90.8sec 18.25% 18.26% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_turbulent_vial_of_toxin
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:1120.00

Stack Uptimes

  • turbulent_vial_of_toxin_1:18.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:176883
  • name:Turbulent Vial of Toxin
  • tooltip:Mastery increased by {$s1=870}.
  • description:Grants {$s1=870} Mastery for {$d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rosalîîe
a_murder_of_crows Focus 5.3 158.4 30.0 30.0 2954.5
arcane_shot Focus 42.2 626.5 14.9 14.9 988.0
barrage Focus 11.5 692.0 60.0 60.0 959.3
black_arrow Focus 12.4 434.3 35.0 35.0 2372.0
explosive_shot Focus 73.9 663.3 9.0 9.0 2848.3
Resource Gains Type Count Total Average Overflow
focus_regen Focus 222.96 1402.92 (44.27%) 6.29 8.18 0.58%
external_healing Health 8.59 0.00 (0.00%) 0.00 79403.20 100.00%
thrill_of_the_hunt_savings Focus 33.79 675.75 (21.32%) 20.00 0.00 0.00%
cobra_shot Focus 78.06 1090.55 (34.41%) 13.97 2.35 0.21%
Resource RPS-Gain RPS-Loss
Focus 8.29 8.56
Combat End Resource Mean Min Max
Focus 19.13 0.01 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.3%
cat-Focus Cap 0.3%
devilsaur-Focus Cap 0.3%
raptor-Focus Cap 0.3%
hyena-Focus Cap 0.3%
wolf-Focus Cap 0.3%
wasp-Focus Cap 0.3%
t17_pet_2-Focus Cap 0.3%
t17_pet_1-Focus Cap 0.3%
dire_beast_1-Focus Cap 0.3%
dire_beast_2-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%

Procs

Count Interval
starved: black_arrow 2.5 34.0sec
starved: explosive_shot 0.7 56.4sec
starved: a_murder_of_crows 1.3 41.2sec
starved: barrage 17.3 16.8sec
thrill_of_the_hunt 14.5 20.0sec
lock_and_load 15.0 19.8sec

Statistics & Data Analysis

Fight Length
Sample Data Rosalîîe Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Rosalîîe Damage Per Second
Count 25000
Mean 23204.55
Minimum 21400.12
Maximum 25553.70
Spread ( max - min ) 4153.57
Range [ ( max - min ) / 2 * 100% ] 8.95%
Standard Deviation 464.7813
5th Percentile 22482.88
95th Percentile 23996.90
( 95th Percentile - 5th Percentile ) 1514.02
Mean Distribution
Standard Deviation 2.9395
95.00% Confidence Intervall ( 23198.79 - 23210.31 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1541
0.1 Scale Factor Error with Delta=300 1844
0.05 Scale Factor Error with Delta=300 7376
0.01 Scale Factor Error with Delta=300 184408
Distribution Chart
DPS(e)
Sample Data Rosalîîe Damage Per Second (Effective)
Count 25000
Mean 23204.55
Minimum 21400.12
Maximum 25553.70
Spread ( max - min ) 4153.57
Range [ ( max - min ) / 2 * 100% ] 8.95%
Damage
Sample Data Rosalîîe Damage
Count 25000
Mean 6975028.43
Minimum 5247569.14
Maximum 8874639.38
Spread ( max - min ) 3627070.24
Range [ ( max - min ) / 2 * 100% ] 26.00%
DTPS
Sample Data Rosalîîe Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rosalîîe Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Rosalîîe Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rosalîîe Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rosalîîe Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rosalîîe Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RosalîîeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Rosalîîe Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 use_item,name=belt_of_imminent_lies
9 3.75 use_item,name=turbulent_vial_of_toxin
A 0.00 arcane_torrent,if=focus.deficit>=30
B 0.00 blood_fury
C 0.00 berserking
D 1.00 potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
E 0.00 call_action_list,name=aoe,if=active_enemies>1
F 0.00 stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
G 12.41 black_arrow,if=!ticking
H 73.87 explosive_shot
I 5.28 a_murder_of_crows
J 0.00 dire_beast
K 39.36 arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
L 0.00 glaive_toss
M 0.00 powershot
N 11.53 barrage
O 0.00 cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Cast a second shot for steady focus if that won't cap us.
P 2.81 arcane_shot,if=focus>=80|talent.focusing_shot.enabled
Q 0.00 focusing_shot
R 78.69 cobra_shot

Sample Sequence

01679GHIKRRRHHHHNRKKHRKRRGHRRPRHPNRRHKKKRHHHRGKKKHRRRHNIRHRHHHKRRGHRHHHRKRKHK9RRNHHHRGRRHHHKRHHHRHHHNKRHRRGIRHRHHHKRRRHNRRHGKRHHHKKRRHNRRHRRGK9HRKKRHKKDKIRHRHHHRRGRHHHHKKKRRHNRKHKKRGRHHHHRKKKKHRRRHNRGHRRIKHRRKKHRR9NHHHRGRRHKRRRHNKRH

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 use_item_turbulent_vial_of_toxin Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 black_arrow Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion, turbulent_vial_of_toxin
0:01.005 explosive_shot Fluffy_Pillow 70.9/100: 71% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:02.009 a_murder_of_crows Fluffy_Pillow 61.8/100: 62% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:03.012 arcane_shot Fluffy_Pillow 37.7/100: 38% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:04.016 cobra_shot Fluffy_Pillow 13.6/100: 14% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:05.384 cobra_shot Fluffy_Pillow 21.6/100: 22% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:06.751 cobra_shot Fluffy_Pillow 43.7/100: 44% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:08.118 explosive_shot Fluffy_Pillow 65.7/100: 66% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:09.123 explosive_shot Fluffy_Pillow 70.6/100: 71% focus bloodlust, lock_and_load(2), oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:10.128 explosive_shot Fluffy_Pillow 76.5/100: 76% focus bloodlust, lock_and_load, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:11.133 explosive_shot Fluffy_Pillow 82.4/100: 82% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
0:12.139 barrage Fluffy_Pillow 73.3/100: 73% focus bloodlust, thrill_of_the_hunt(3), draenic_agility_potion, turbulent_vial_of_toxin
0:14.519 cobra_shot Fluffy_Pillow 27.3/100: 27% focus bloodlust, thrill_of_the_hunt(3), draenic_agility_potion, turbulent_vial_of_toxin
0:15.885 arcane_shot Fluffy_Pillow 35.3/100: 35% focus bloodlust, thrill_of_the_hunt(3), draenic_agility_potion
0:16.889 arcane_shot Fluffy_Pillow 45.2/100: 45% focus bloodlust, thrill_of_the_hunt(2), draenic_agility_potion
0:17.894 explosive_shot Fluffy_Pillow 41.1/100: 41% focus bloodlust, thrill_of_the_hunt, draenic_agility_potion
0:18.897 cobra_shot Fluffy_Pillow 32.0/100: 32% focus bloodlust, thrill_of_the_hunt, draenic_agility_potion
0:20.263 arcane_shot Fluffy_Pillow 40.0/100: 40% focus bloodlust, thrill_of_the_hunt
0:21.268 cobra_shot Fluffy_Pillow 49.9/100: 50% focus bloodlust
0:22.635 cobra_shot Fluffy_Pillow 57.9/100: 58% focus bloodlust, oglethorpes_missile_splitter
0:24.002 black_arrow Fluffy_Pillow 80.0/100: 80% focus bloodlust, oglethorpes_missile_splitter
0:25.006 explosive_shot Fluffy_Pillow 64.9/100: 65% focus bloodlust, oglethorpes_missile_splitter
0:26.010 cobra_shot Fluffy_Pillow 55.8/100: 56% focus bloodlust, oglethorpes_missile_splitter
0:27.376 cobra_shot Fluffy_Pillow 63.8/100: 64% focus bloodlust, oglethorpes_missile_splitter
0:28.742 arcane_shot Fluffy_Pillow 85.8/100: 86% focus bloodlust, oglethorpes_missile_splitter
0:29.749 cobra_shot Fluffy_Pillow 75.7/100: 76% focus bloodlust, oglethorpes_missile_splitter
0:31.116 explosive_shot Fluffy_Pillow 83.8/100: 84% focus bloodlust, oglethorpes_missile_splitter
0:32.119 arcane_shot Fluffy_Pillow 88.6/100: 89% focus bloodlust, oglethorpes_missile_splitter
0:33.124 barrage Fluffy_Pillow 64.5/100: 65% focus bloodlust, thrill_of_the_hunt(3), oglethorpes_missile_splitter
0:35.470 cobra_shot Fluffy_Pillow 18.3/100: 18% focus bloodlust, thrill_of_the_hunt(3), oglethorpes_missile_splitter
0:36.835 cobra_shot Fluffy_Pillow 26.3/100: 26% focus bloodlust, thrill_of_the_hunt(3), oglethorpes_missile_splitter
0:38.204 explosive_shot Fluffy_Pillow 48.4/100: 48% focus bloodlust, thrill_of_the_hunt(3)
0:39.208 arcane_shot Fluffy_Pillow 53.3/100: 53% focus bloodlust, thrill_of_the_hunt(3)
0:40.213 arcane_shot Fluffy_Pillow 49.2/100: 49% focus bloodlust, thrill_of_the_hunt(2)
0:41.219 arcane_shot Fluffy_Pillow 43.7/100: 44% focus thrill_of_the_hunt
0:42.225 cobra_shot Fluffy_Pillow 38.3/100: 38% focus
0:44.001 explosive_shot Fluffy_Pillow 46.3/100: 46% focus lock_and_load(2)
0:45.006 explosive_shot Fluffy_Pillow 64.8/100: 65% focus lock_and_load
0:46.010 explosive_shot Fluffy_Pillow 69.4/100: 69% focus
0:47.014 cobra_shot Fluffy_Pillow 58.9/100: 59% focus oglethorpes_missile_splitter
0:48.789 black_arrow Fluffy_Pillow 66.9/100: 67% focus oglethorpes_missile_splitter
0:49.794 arcane_shot Fluffy_Pillow 50.5/100: 50% focus thrill_of_the_hunt(3), oglethorpes_missile_splitter
0:50.797 arcane_shot Fluffy_Pillow 45.0/100: 45% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
0:51.801 arcane_shot Fluffy_Pillow 39.5/100: 40% focus thrill_of_the_hunt, oglethorpes_missile_splitter
0:52.805 explosive_shot Fluffy_Pillow 34.1/100: 34% focus oglethorpes_missile_splitter
0:53.809 cobra_shot Fluffy_Pillow 23.6/100: 24% focus oglethorpes_missile_splitter
0:55.582 cobra_shot Fluffy_Pillow 31.6/100: 32% focus oglethorpes_missile_splitter
0:57.356 cobra_shot Fluffy_Pillow 53.6/100: 54% focus oglethorpes_missile_splitter
0:59.131 explosive_shot Fluffy_Pillow 75.7/100: 76% focus
1:00.135 barrage Fluffy_Pillow 79.2/100: 79% focus
1:03.113 a_murder_of_crows Fluffy_Pillow 32.6/100: 33% focus
1:04.117 cobra_shot Fluffy_Pillow 7.2/100: 7% focus
1:05.891 explosive_shot Fluffy_Pillow 15.2/100: 15% focus
1:06.896 cobra_shot Fluffy_Pillow 18.7/100: 19% focus
1:08.671 explosive_shot Fluffy_Pillow 26.8/100: 27% focus lock_and_load(2)
1:09.675 explosive_shot Fluffy_Pillow 45.3/100: 45% focus lock_and_load
1:10.680 explosive_shot Fluffy_Pillow 49.8/100: 50% focus
1:11.685 arcane_shot Fluffy_Pillow 39.4/100: 39% focus
1:12.688 cobra_shot Fluffy_Pillow 13.9/100: 14% focus
1:14.463 cobra_shot Fluffy_Pillow 21.9/100: 22% focus
1:16.237 black_arrow Fluffy_Pillow 43.9/100: 44% focus oglethorpes_missile_splitter
1:17.242 explosive_shot Fluffy_Pillow 27.5/100: 27% focus oglethorpes_missile_splitter
1:18.247 cobra_shot Fluffy_Pillow 17.0/100: 17% focus oglethorpes_missile_splitter
1:20.020 explosive_shot Fluffy_Pillow 25.0/100: 25% focus lock_and_load(2), oglethorpes_missile_splitter
1:21.024 explosive_shot Fluffy_Pillow 43.6/100: 44% focus lock_and_load, oglethorpes_missile_splitter
1:22.031 explosive_shot Fluffy_Pillow 48.1/100: 48% focus oglethorpes_missile_splitter
1:23.037 cobra_shot Fluffy_Pillow 37.7/100: 38% focus oglethorpes_missile_splitter
1:24.811 arcane_shot Fluffy_Pillow 45.7/100: 46% focus oglethorpes_missile_splitter
1:25.815 cobra_shot Fluffy_Pillow 34.2/100: 34% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
1:27.587 arcane_shot Fluffy_Pillow 42.2/100: 42% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
1:28.592 explosive_shot Fluffy_Pillow 50.8/100: 51% focus thrill_of_the_hunt
1:29.597 arcane_shot Fluffy_Pillow 40.3/100: 40% focus thrill_of_the_hunt
1:30.601 use_item_turbulent_vial_of_toxin Fluffy_Pillow 34.8/100: 35% focus
1:30.601 cobra_shot Fluffy_Pillow 34.8/100: 35% focus turbulent_vial_of_toxin
1:32.375 cobra_shot Fluffy_Pillow 42.8/100: 43% focus turbulent_vial_of_toxin
1:34.150 barrage Fluffy_Pillow 64.9/100: 65% focus turbulent_vial_of_toxin
1:37.007 explosive_shot Fluffy_Pillow 31.8/100: 32% focus lock_and_load(2), turbulent_vial_of_toxin
1:38.012 explosive_shot Fluffy_Pillow 36.3/100: 36% focus lock_and_load, turbulent_vial_of_toxin
1:39.017 explosive_shot Fluffy_Pillow 40.9/100: 41% focus turbulent_vial_of_toxin
1:40.021 cobra_shot Fluffy_Pillow 30.4/100: 30% focus turbulent_vial_of_toxin
1:41.795 black_arrow Fluffy_Pillow 38.4/100: 38% focus turbulent_vial_of_toxin
1:42.801 cobra_shot Fluffy_Pillow 22.0/100: 22% focus turbulent_vial_of_toxin
1:44.574 cobra_shot Fluffy_Pillow 30.0/100: 30% focus turbulent_vial_of_toxin
1:46.348 explosive_shot Fluffy_Pillow 52.0/100: 52% focus lock_and_load(2)
1:47.352 explosive_shot Fluffy_Pillow 70.5/100: 71% focus lock_and_load
1:48.356 explosive_shot Fluffy_Pillow 75.0/100: 75% focus
1:49.360 arcane_shot Fluffy_Pillow 64.6/100: 65% focus
1:50.364 cobra_shot Fluffy_Pillow 39.1/100: 39% focus
1:52.138 explosive_shot Fluffy_Pillow 47.1/100: 47% focus lock_and_load(2)
1:53.143 explosive_shot Fluffy_Pillow 65.7/100: 66% focus lock_and_load
1:54.149 explosive_shot Fluffy_Pillow 70.2/100: 70% focus
1:55.155 cobra_shot Fluffy_Pillow 59.8/100: 60% focus
1:56.930 explosive_shot Fluffy_Pillow 67.8/100: 68% focus lock_and_load(2)
1:57.935 explosive_shot Fluffy_Pillow 86.3/100: 86% focus lock_and_load
1:58.938 explosive_shot Fluffy_Pillow 90.9/100: 91% focus oglethorpes_missile_splitter
1:59.944 barrage Fluffy_Pillow 80.4/100: 80% focus oglethorpes_missile_splitter
2:02.778 arcane_shot Fluffy_Pillow 33.2/100: 33% focus oglethorpes_missile_splitter
2:03.782 cobra_shot Fluffy_Pillow 7.7/100: 8% focus oglethorpes_missile_splitter
2:05.557 explosive_shot Fluffy_Pillow 15.8/100: 16% focus oglethorpes_missile_splitter
2:06.564 cobra_shot Fluffy_Pillow 19.3/100: 19% focus oglethorpes_missile_splitter
2:08.339 cobra_shot Fluffy_Pillow 27.3/100: 27% focus oglethorpes_missile_splitter
2:10.114 black_arrow Fluffy_Pillow 49.4/100: 49% focus oglethorpes_missile_splitter
2:11.119 a_murder_of_crows Fluffy_Pillow 32.9/100: 33% focus oglethorpes_missile_splitter
2:12.124 cobra_shot Fluffy_Pillow 7.4/100: 7% focus oglethorpes_missile_splitter
2:13.898 explosive_shot Fluffy_Pillow 15.4/100: 15% focus oglethorpes_missile_splitter
2:14.904 cobra_shot Fluffy_Pillow 19.0/100: 19% focus
2:16.678 explosive_shot Fluffy_Pillow 27.0/100: 27% focus lock_and_load(2)
2:17.681 explosive_shot Fluffy_Pillow 45.5/100: 46% focus lock_and_load
2:18.687 explosive_shot Fluffy_Pillow 50.1/100: 50% focus
2:19.693 arcane_shot Fluffy_Pillow 39.6/100: 40% focus
2:20.699 cobra_shot Fluffy_Pillow 14.2/100: 14% focus
2:22.472 cobra_shot Fluffy_Pillow 22.2/100: 22% focus
2:24.246 cobra_shot Fluffy_Pillow 44.2/100: 44% focus
2:26.021 explosive_shot Fluffy_Pillow 66.2/100: 66% focus
2:27.025 barrage Fluffy_Pillow 69.8/100: 70% focus
2:29.863 cobra_shot Fluffy_Pillow 22.6/100: 23% focus
2:31.637 cobra_shot Fluffy_Pillow 30.6/100: 31% focus
2:33.411 explosive_shot Fluffy_Pillow 52.6/100: 53% focus
2:34.417 black_arrow Fluffy_Pillow 56.2/100: 56% focus
2:35.421 arcane_shot Fluffy_Pillow 25.7/100: 26% focus thrill_of_the_hunt(3)
2:36.425 cobra_shot Fluffy_Pillow 20.2/100: 20% focus thrill_of_the_hunt(2)
2:38.198 explosive_shot Fluffy_Pillow 28.2/100: 28% focus thrill_of_the_hunt(2), lock_and_load(2)
2:39.204 explosive_shot Fluffy_Pillow 46.8/100: 47% focus thrill_of_the_hunt(2), lock_and_load
2:40.208 explosive_shot Fluffy_Pillow 51.3/100: 51% focus thrill_of_the_hunt(2)
2:41.213 arcane_shot Fluffy_Pillow 40.9/100: 41% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
2:42.217 arcane_shot Fluffy_Pillow 35.4/100: 35% focus thrill_of_the_hunt, oglethorpes_missile_splitter
2:43.223 cobra_shot Fluffy_Pillow 29.9/100: 30% focus oglethorpes_missile_splitter
2:44.998 cobra_shot Fluffy_Pillow 38.0/100: 38% focus oglethorpes_missile_splitter
2:46.772 explosive_shot Fluffy_Pillow 60.0/100: 60% focus oglethorpes_missile_splitter
2:47.776 barrage Fluffy_Pillow 63.5/100: 64% focus oglethorpes_missile_splitter
2:50.778 cobra_shot Fluffy_Pillow 17.1/100: 17% focus oglethorpes_missile_splitter
2:52.552 cobra_shot Fluffy_Pillow 25.1/100: 25% focus
2:54.327 explosive_shot Fluffy_Pillow 47.1/100: 47% focus
2:55.333 cobra_shot Fluffy_Pillow 50.6/100: 51% focus
2:57.108 cobra_shot Fluffy_Pillow 58.7/100: 59% focus
2:58.883 black_arrow Fluffy_Pillow 80.7/100: 81% focus oglethorpes_missile_splitter
2:59.888 arcane_shot Fluffy_Pillow 64.2/100: 64% focus oglethorpes_missile_splitter
3:00.894 use_item_turbulent_vial_of_toxin Fluffy_Pillow 38.8/100: 39% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
3:00.894 explosive_shot Fluffy_Pillow 38.8/100: 39% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter, turbulent_vial_of_toxin
3:01.898 cobra_shot Fluffy_Pillow 28.3/100: 28% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter, turbulent_vial_of_toxin
3:03.672 arcane_shot Fluffy_Pillow 36.3/100: 36% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter, turbulent_vial_of_toxin
3:04.678 arcane_shot Fluffy_Pillow 44.9/100: 45% focus thrill_of_the_hunt, oglethorpes_missile_splitter, turbulent_vial_of_toxin
3:05.682 cobra_shot Fluffy_Pillow 39.4/100: 39% focus oglethorpes_missile_splitter, turbulent_vial_of_toxin
3:07.455 explosive_shot Fluffy_Pillow 47.4/100: 47% focus oglethorpes_missile_splitter, turbulent_vial_of_toxin
3:08.461 arcane_shot Fluffy_Pillow 51.0/100: 51% focus thrill_of_the_hunt(3), oglethorpes_missile_splitter, turbulent_vial_of_toxin
3:09.467 arcane_shot Fluffy_Pillow 45.5/100: 46% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter, turbulent_vial_of_toxin
3:10.471 potion Fluffy_Pillow 40.0/100: 40% focus thrill_of_the_hunt, oglethorpes_missile_splitter, turbulent_vial_of_toxin
3:10.471 arcane_shot Fluffy_Pillow 40.0/100: 40% focus thrill_of_the_hunt, oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
3:11.475 a_murder_of_crows Fluffy_Pillow 34.6/100: 35% focus oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
3:12.479 cobra_shot Fluffy_Pillow 9.1/100: 9% focus oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
3:14.253 explosive_shot Fluffy_Pillow 17.1/100: 17% focus oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
3:15.258 cobra_shot Fluffy_Pillow 20.7/100: 21% focus oglethorpes_missile_splitter, draenic_agility_potion, turbulent_vial_of_toxin
3:17.033 explosive_shot Fluffy_Pillow 28.7/100: 29% focus lock_and_load(2), oglethorpes_missile_splitter, draenic_agility_potion
3:18.038 explosive_shot Fluffy_Pillow 47.2/100: 47% focus lock_and_load, oglethorpes_missile_splitter, draenic_agility_potion
3:19.043 explosive_shot Fluffy_Pillow 51.8/100: 52% focus oglethorpes_missile_splitter, draenic_agility_potion
3:20.048 cobra_shot Fluffy_Pillow 41.3/100: 41% focus oglethorpes_missile_splitter, draenic_agility_potion
3:21.823 cobra_shot Fluffy_Pillow 49.3/100: 49% focus oglethorpes_missile_splitter, draenic_agility_potion
3:23.597 black_arrow Fluffy_Pillow 71.3/100: 71% focus oglethorpes_missile_splitter, draenic_agility_potion
3:24.602 cobra_shot Fluffy_Pillow 54.9/100: 55% focus oglethorpes_missile_splitter, draenic_agility_potion
3:26.375 explosive_shot Fluffy_Pillow 62.9/100: 63% focus oglethorpes_missile_splitter, draenic_agility_potion
3:27.380 explosive_shot Fluffy_Pillow 66.4/100: 66% focus thrill_of_the_hunt(3), lock_and_load(2), oglethorpes_missile_splitter, draenic_agility_potion
3:28.385 explosive_shot Fluffy_Pillow 71.0/100: 71% focus thrill_of_the_hunt(3), lock_and_load, oglethorpes_missile_splitter, draenic_agility_potion
3:29.392 explosive_shot Fluffy_Pillow 75.5/100: 76% focus thrill_of_the_hunt(3), oglethorpes_missile_splitter, draenic_agility_potion
3:30.395 arcane_shot Fluffy_Pillow 65.1/100: 65% focus thrill_of_the_hunt(3), oglethorpes_missile_splitter, draenic_agility_potion
3:31.400 arcane_shot Fluffy_Pillow 59.6/100: 60% focus thrill_of_the_hunt(2), draenic_agility_potion
3:32.405 arcane_shot Fluffy_Pillow 54.1/100: 54% focus thrill_of_the_hunt, draenic_agility_potion
3:33.408 cobra_shot Fluffy_Pillow 48.7/100: 49% focus draenic_agility_potion
3:35.182 cobra_shot Fluffy_Pillow 56.7/100: 57% focus draenic_agility_potion
3:36.956 explosive_shot Fluffy_Pillow 78.7/100: 79% focus
3:37.961 barrage Fluffy_Pillow 82.2/100: 82% focus thrill_of_the_hunt(3)
3:40.772 cobra_shot Fluffy_Pillow 34.9/100: 35% focus thrill_of_the_hunt(3)
3:42.547 arcane_shot Fluffy_Pillow 43.0/100: 43% focus thrill_of_the_hunt(3)
3:43.553 explosive_shot Fluffy_Pillow 51.5/100: 52% focus thrill_of_the_hunt(2)
3:44.558 arcane_shot Fluffy_Pillow 41.0/100: 41% focus thrill_of_the_hunt(2)
3:45.562 arcane_shot Fluffy_Pillow 35.6/100: 36% focus thrill_of_the_hunt
3:46.567 cobra_shot Fluffy_Pillow 30.1/100: 30% focus thrill_of_the_hunt(2)
3:48.340 black_arrow Fluffy_Pillow 38.1/100: 38% focus thrill_of_the_hunt(2)
3:49.344 cobra_shot Fluffy_Pillow 21.7/100: 22% focus thrill_of_the_hunt(2)
3:51.119 explosive_shot Fluffy_Pillow 29.7/100: 30% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
3:52.124 explosive_shot Fluffy_Pillow 33.2/100: 33% focus thrill_of_the_hunt(2), lock_and_load(2), oglethorpes_missile_splitter
3:53.129 explosive_shot Fluffy_Pillow 37.8/100: 38% focus thrill_of_the_hunt(2), lock_and_load, oglethorpes_missile_splitter
3:54.134 explosive_shot Fluffy_Pillow 42.3/100: 42% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
3:55.137 cobra_shot Fluffy_Pillow 31.8/100: 32% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
3:56.912 arcane_shot Fluffy_Pillow 39.9/100: 40% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
3:57.916 arcane_shot Fluffy_Pillow 48.4/100: 48% focus thrill_of_the_hunt, oglethorpes_missile_splitter
3:58.922 arcane_shot Fluffy_Pillow 42.9/100: 43% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
3:59.924 arcane_shot Fluffy_Pillow 37.5/100: 37% focus thrill_of_the_hunt, oglethorpes_missile_splitter
4:00.928 explosive_shot Fluffy_Pillow 32.0/100: 32% focus oglethorpes_missile_splitter
4:01.931 cobra_shot Fluffy_Pillow 21.5/100: 22% focus oglethorpes_missile_splitter
4:03.706 cobra_shot Fluffy_Pillow 29.6/100: 30% focus
4:05.480 cobra_shot Fluffy_Pillow 51.6/100: 52% focus
4:07.255 explosive_shot Fluffy_Pillow 73.6/100: 74% focus
4:08.258 barrage Fluffy_Pillow 77.1/100: 77% focus thrill_of_the_hunt(3)
4:11.147 cobra_shot Fluffy_Pillow 30.2/100: 30% focus thrill_of_the_hunt(3)
4:12.921 black_arrow Fluffy_Pillow 38.2/100: 38% focus thrill_of_the_hunt(3)
4:13.927 explosive_shot Fluffy_Pillow 21.7/100: 22% focus thrill_of_the_hunt(3)
4:14.932 cobra_shot Fluffy_Pillow 11.3/100: 11% focus thrill_of_the_hunt(3)
4:16.707 cobra_shot Fluffy_Pillow 19.3/100: 19% focus thrill_of_the_hunt(3)
4:18.481 a_murder_of_crows Fluffy_Pillow 41.3/100: 41% focus thrill_of_the_hunt(3)
4:19.484 arcane_shot Fluffy_Pillow 29.8/100: 30% focus thrill_of_the_hunt(3)
4:20.488 explosive_shot Fluffy_Pillow 24.4/100: 24% focus thrill_of_the_hunt(2)
4:21.492 cobra_shot Fluffy_Pillow 13.9/100: 14% focus thrill_of_the_hunt(2)
4:23.267 cobra_shot Fluffy_Pillow 21.9/100: 22% focus thrill_of_the_hunt(2)
4:25.039 arcane_shot Fluffy_Pillow 43.9/100: 44% focus thrill_of_the_hunt(2)
4:26.045 arcane_shot Fluffy_Pillow 52.5/100: 52% focus thrill_of_the_hunt
4:27.049 explosive_shot Fluffy_Pillow 47.0/100: 47% focus
4:28.052 cobra_shot Fluffy_Pillow 36.5/100: 37% focus
4:29.826 cobra_shot Fluffy_Pillow 44.6/100: 45% focus
4:31.601 use_item_turbulent_vial_of_toxin Fluffy_Pillow 66.6/100: 67% focus
4:31.601 barrage Fluffy_Pillow 66.6/100: 67% focus turbulent_vial_of_toxin
4:34.447 explosive_shot Fluffy_Pillow 33.4/100: 33% focus lock_and_load(2), turbulent_vial_of_toxin
4:35.452 explosive_shot Fluffy_Pillow 38.0/100: 38% focus lock_and_load, turbulent_vial_of_toxin
4:36.455 explosive_shot Fluffy_Pillow 42.5/100: 43% focus turbulent_vial_of_toxin
4:37.458 cobra_shot Fluffy_Pillow 32.0/100: 32% focus turbulent_vial_of_toxin
4:39.233 black_arrow Fluffy_Pillow 40.1/100: 40% focus turbulent_vial_of_toxin
4:40.236 cobra_shot Fluffy_Pillow 23.6/100: 24% focus turbulent_vial_of_toxin
4:42.010 cobra_shot Fluffy_Pillow 31.6/100: 32% focus turbulent_vial_of_toxin
4:43.785 explosive_shot Fluffy_Pillow 53.6/100: 54% focus turbulent_vial_of_toxin
4:44.789 arcane_shot Fluffy_Pillow 57.2/100: 57% focus turbulent_vial_of_toxin
4:45.794 cobra_shot Fluffy_Pillow 31.7/100: 32% focus turbulent_vial_of_toxin
4:47.569 cobra_shot Fluffy_Pillow 39.7/100: 40% focus
4:49.343 cobra_shot Fluffy_Pillow 61.7/100: 62% focus
4:51.116 explosive_shot Fluffy_Pillow 83.7/100: 84% focus
4:52.121 barrage Fluffy_Pillow 87.3/100: 87% focus
4:54.977 arcane_shot Fluffy_Pillow 40.2/100: 40% focus
4:55.980 cobra_shot Fluffy_Pillow 14.7/100: 15% focus
4:57.755 explosive_shot Fluffy_Pillow 22.7/100: 23% focus

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 930 886 886
Agility 4310 3842 3724 (1414)
Stamina 4428 4026 4026
Intellect 895 853 853
Spirit 713 713 713
Health 265680 241560 0
Focus 100 100 0
Crit 30.68% 23.86% 975
Haste 12.95% 7.57% 757
Multistrike 12.17% 7.17% 473
Damage / Heal Versatility 8.37% 5.37% 698
Attack Power 4741 3842 0
Mastery 15.74% 10.74% 301
Armor 1241 1241 1241
Run Speed 0 0 90

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Survival Hunter) Lone Wolf

Profile

hunter="Rosalîîe"
origin="http://eu.battle.net/wow/en/character/die-nachtwache/Rosalîîe/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/37/85695781-avatar.jpg"
level=100
race=pandaren_alliance
role=attack
position=ranged_back
professions=engineering=667/enchanting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Yb!0012022
glyphs=deterrence/black_ice/liberation/aspect_of_the_cheetah
spec=survival

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/use_item,name=belt_of_imminent_lies
actions+=/use_item,name=turbulent_vial_of_toxin
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
actions+=/call_action_list,name=aoe,if=active_enemies>1
actions+=/stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
actions+=/black_arrow,if=!ticking
actions+=/explosive_shot
actions+=/a_murder_of_crows
actions+=/dire_beast
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
actions+=/glaive_toss
actions+=/powershot
actions+=/barrage
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
actions+=/arcane_shot,if=focus>=80|talent.focusing_shot.enabled
actions+=/focusing_shot
actions+=/cobra_shot

actions.aoe=stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up|buff.archmages_incandescence_agi.up))
actions.aoe+=/explosive_shot,if=buff.lock_and_load.react&(!talent.barrage.enabled|cooldown.barrage.remains>0)
actions.aoe+=/barrage
actions.aoe+=/black_arrow,if=!ticking
actions.aoe+=/explosive_shot,if=active_enemies<5
actions.aoe+=/explosive_trap,if=dot.explosive_trap.remains<=5
actions.aoe+=/a_murder_of_crows
actions.aoe+=/dire_beast
actions.aoe+=/multishot,if=buff.thrill_of_the_hunt.react&focus>50&cast_regen<=focus.deficit|dot.serpent_sting.remains<=5|target.time_to_die<4.5
actions.aoe+=/glaive_toss
actions.aoe+=/powershot
actions.aoe+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&focus+14+cast_regen<80
actions.aoe+=/multishot,if=focus>=70|talent.focusing_shot.enabled
actions.aoe+=/focusing_shot
actions.aoe+=/cobra_shot

head=hood_of_dispassionate_execution,id=113608
neck=earthcallers_charm,id=120083,enchant=75mult
shoulders=living_mountain_shoulderguards,id=113641,bonus_id=42
back=cloak_of_creeping_necrosis,id=113657,bonus_id=563,gems=35mult,enchant=gift_of_multistrike
chest=mosswoven_mailshirt,id=113654
wrists=bracers_of_the_crying_chorus,id=113826
hands=grips_of_vicious_mauling,id=113593,bonus_id=566
waist=belt_of_imminent_lies,id=113827,bonus_id=560,addon=nitro_boosts
legs=legguards_of_ravenous_assault,id=116032
feet=treads_of_sand_and_blood,id=113595,bonus_id=566
finger1=shifting_taladite_ring,id=115796,bonus_id=234/525/540,enchant=50mult
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=50mult
trinket1=bloodmaws_tooth,id=116289
trinket2=turbulent_vial_of_toxin,id=114488,bonus_id=560
main_hand=grandiose_longbow,id=115329,bonus_id=490,enchant=oglethorpes_missile_splitter

# Gear Summary
# gear_agility=2378
# gear_stamina=3135
# gear_crit_rating=975
# gear_haste_rating=757
# gear_mastery_rating=301
# gear_armor=1241
# gear_multistrike_rating=450
# gear_versatility_rating=698
# gear_speed_rating=90
summon_pet=cat

Procrank

Procrank : 24463 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
24462.6 24462.6 11.1 / 0.046% 3440.1 / 14.1% 6.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
2776.0 2776.0 Mana 0.00% 43.1 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Procrank/advanced
Talents
  • 15: Ice Floes
  • 30: Ice Barrier
  • 45: Ring of Frost
  • 60: Cauterize
  • 75: Ice Nova (Frost Mage)
  • 90: Mirror Image
  • 100: Thermal Void (Frost Mage)
  • Talent Calculator
Glyphs
  • Glyph of Icy Veins
  • Glyph of Water Elemental
  • Glyph of Splitting Ice
  • Glyph of the Unbound Elemental
  • Glyph of Illusion
  • Glyph of Rapid Teleportation
Professions
  • inscription: 664
  • tailoring: 636

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Procrank+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:381029|36145|35991|33499|20645|10869&chds=0,762058&chco=69CCF0,0070DE,9900CC,0070DE,0070DE,0070DE&chm=t++381029++mirror_image,69CCF0,0,0,15|t++36145++ice_nova,0070DE,1,0,15|t++35991++frostfire_bolt,9900CC,2,0,15|t++33499++frozen_orb,0070DE,3,0,15|t++20645++ice_lance,0070DE,4,0,15|t++10869++frostbolt,0070DE,5,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Procrank+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,24,19,18,11,11,10,7,4,2,2&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,9900CC,0070DE,0070DE,0070DE,9900CC,0070DE,C79C6E,0070DE&chl=ice_lance|frostbolt|mirror_image: frostbolt|frostfire_bolt|ice_nova|water_elemental: waterbolt|icicle_fb|icicle_ffb|frozen_orb_bolt|shattered_bleed|water_elemental: water_jet&
http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Procrank+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:eikoruwz2465742343420zyxvtusrrqpnnlkhfdccbbaZYWWUTSRRSSSSTTTTTSSSTUVVVVVVUTTTSSSSSSSSRQQPPPQSSSSSSSSTSSSSSSSSSSRPPQRSUVWWXXYZZabbcdeefeecbaaabbbbbaaaZZZZZZZYYYYXWVUUTTTSSTTTTUUVWWXYZaabcdeffefhhhhgffeeddcbbbaZZYWUUUTUVVVUUUTTTTSSSSSSSRSRRSTTVWXYZZaabccdeeeeddccbaZZZabbaaZZZZYYYYYYXXWWWUTSSSSTTSSSSSSSSTTTTTUUUUTTTTTUUUTTSSSSSRRRRRRRRRRQPQQRRSSSSSSSSSSSSSSSSTTTTSUTSRQQPONMM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.438935,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=24463|max=55732&chxp=1,1,44,100 http://0.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Procrank+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:5,5,13,13,27,46,87,131,215,285,334,478,548,668,754,834,979,1101,1124,1189,1215,1260,1288,1333,1219,1338,1253,1110,1096,897,832,771,594,509,383,316,207,173,128,94,49,35,19,18,11,5,8,2,0,1&chds=0,1338&chbh=5&chxt=x&chxl=0:|min=21573|avg=24463|max=27889&chxp=0,1,46,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Procrank+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:56.9,21.3,12.7,5.7,2.4,0.9&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,69CCF0&chl=frostbolt 171.2s|ice_lance 64.1s|frostfire_bolt 38.1s|ice_nova 17.3s|frozen_orb 7.3s|mirror_image 2.7s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Procrank 24463
frostbolt 4381 (6194) 17.9% (25.4%) 103.7 2.87sec 17953 10869 Direct 103.4 9081 18312 10331 13.5% 77.9 2781 5638 14.0%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.66 103.42 0.00 0.00 1.6519 0.0000 1316244.30 1316244.30 0.00 10868.52 10868.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.91 14.01% 5638.35 5318 6466 5642.90 5318 6466 61526 61526 0.00
multistrike 66.98 85.99% 2781.27 2659 3233 2782.91 2685 2895 186277 186277 0.00
hit 89.41 86.46% 9081.12 8863 10777 9084.83 8933 9303 811957 811957 0.00
crit 14.01 13.54% 18312.11 17726 21554 18324.06 17726 21554 256485 256485 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%.]
  • description:Launches a bolt of frost at the enemy, causing {$s2=1256} Frost damage and slowing movement speed by {$s1=50}% for {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.191000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    icicle_fb 1814 7.4% 179.2 1.98sec 3040 0 Direct 178.1 3058 0 3058 0.0% 0.0 0 0 0.0%  

Stats details: icicle_fb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 179.23 178.14 0.00 0.00 0.0000 0.0000 544826.24 544826.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.14 100.00% 3058.32 1072 14566 3059.93 2446 4009 544826 544826 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3371.46
  • base_dd_max:3371.46
 
frostfire_bolt 3310 (4577) 13.5% (18.7%) 29.7 9.85sec 46216 35991 Direct 29.6 15328 30964 26420 70.9% 25.5 4709 9554 71.9%  

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.67 29.61 0.00 0.00 1.2841 0.0000 991534.87 991534.87 0.00 35990.70 35990.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 18.37 71.92% 9554.19 8907 10831 9561.25 8907 10831 175525 175525 0.00
multistrike 7.17 28.08% 4708.79 4454 5415 4708.45 0 5415 33778 33778 0.00
hit 8.60 29.06% 15328.04 14845 18052 15336.46 0 18052 131875 131875 0.00
crit 21.00 70.94% 30964.16 29690 36103 30987.85 29690 33966 650356 650356 0.00
 
DPS Timeline Chart
 

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by {$s1=40}%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][{$s2=1672}] Frostfire damage and slowing the target's movement by {$s1=40}% for {$d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.586000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    icicle_ffb 1267 5.2% 54.6 5.59sec 6955 0 Direct 54.3 6989 0 6989 0.0% 0.0 0 0 0.0%  

Stats details: icicle_ffb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.58 54.31 0.00 0.00 0.0000 0.0000 379602.89 379602.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.31 100.00% 6989.36 1072 14566 7002.19 5224 9019 379603 379603 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3371.46
  • base_dd_max:3371.46
 
frozen_orb 0 (821) 0.0% (3.4%) 5.4 61.14sec 45337 33499

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.42 5.42 53.16 53.16 1.3535 1.0000 0.00 0.00 0.00 4063.09 33498.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.4 83.55% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.7 16.45% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16000.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=405} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    frozen_orb_bolt 821 3.4% 0.0 0.00sec 0 0 Direct 53.2 3086 6159 3594 16.5% 48.6 968 1933 16.3%  

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 53.16 0.00 0.00 0.0000 0.0000 245812.91 245812.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.95 16.34% 1933.47 1712 2081 1934.85 0 2081 15373 15373 0.00
multistrike 40.70 83.66% 968.26 856 1041 969.41 917 1028 39406 39406 0.00
hit 44.38 83.47% 3085.64 2853 3469 3089.61 2973 3264 136927 136927 0.00
crit 8.79 16.53% 6158.87 5706 6938 6163.79 0 6938 54108 54108 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=30}%.
  • description:{$@spelldesc84714=Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=405} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.383250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
ice_lance 4407 18.0% 49.2 6.08sec 26882 20645 Direct 49.0 12429 25006 21468 71.9% 40.3 3858 7785 72.4%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.20 49.04 0.00 0.00 1.3021 0.0000 1322656.29 1322656.29 0.00 20644.89 20644.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 29.15 72.38% 7784.68 7143 8686 7792.14 7271 8413 226957 226957 0.00
multistrike 11.12 27.62% 3857.78 3571 4343 3861.73 3571 4343 42915 42915 0.00
hit 13.80 28.13% 12429.36 11905 14476 12439.18 11905 14476 171483 171483 0.00
crit 35.24 71.87% 25006.34 23810 28952 25026.76 24024 26689 881301 881301 0.00
 
DPS Timeline Chart
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Deals $?a44544[${$m1*$<fingersMult>} to ${$M1*$<fingersMult>}][{$s1=422}] Frost damage to an enemy target{$?s56377=true}&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]{$?s56377=true}&a44544[, and ${$m1*$<fingersMult>*$56377m2/100} to ${$M1*$<fingersMult>*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is doubled against frozen targets. Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
ice_nova 2082 8.5% 13.4 23.09sec 46413 36145 Direct 13.4 31662 63530 36180 14.2% 12.2 9856 19803 14.3%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.44 13.44 0.00 0.00 1.2841 0.0000 624002.08 624002.08 0.00 36144.70 36144.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.75 14.32% 19802.94 17859 21716 16628.09 0 21716 34597 34597 0.00
multistrike 10.45 85.68% 9856.29 8929 10858 9875.57 8929 10858 102997 102997 0.00
hit 11.54 85.83% 31662.44 29765 36193 31688.96 29765 34050 365349 365349 0.00
crit 1.91 14.17% 63529.74 59529 72386 55417.54 0 72386 121059 121059 0.00
 
DPS Timeline Chart
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=2109} Frost damage to all enemies within $A2 yards, and freezing for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage. Max 2 charges. Replaces Frost Nova.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mirror_image 0 (3449) 0.0% (14.1%) 3.0 121.01sec 343822 381029

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.9027 0.0000 0.00 0.00 0.00 381029.08 381029.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.58 86.08% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.42 13.92% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:
  • description:Creates {$s2=3} copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=40 seconds}.
 
    frostbolt (mirror_image) 9274 14.1% 201.8 4.06sec 5116 3134 Direct 200.8 3413 6927 4034 17.7% 177.6 1052 2149 18.2%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.77 200.80 0.00 0.00 1.6324 0.0000 1032207.77 1032207.77 0.00 3133.92 3133.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 32.30 18.19% 2148.60 1964 2389 2149.98 1989 2320 69392 69392 0.00
multistrike 145.28 81.81% 1052.23 982 1194 1052.92 1026 1101 152871 152871 0.00
hit 165.32 82.33% 3412.75 3274 3981 3414.99 3356 3512 564194 564194 0.00
crit 35.48 17.67% 6927.00 6548 7962 6933.33 6548 7636 245751 245751 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
shattered_bleed 441 1.8% 17.0 18.00sec 7784 0 Direct 17.0 1591 3182 1811 13.8% 13.1 477 955 14.2%  
Periodic 96.2 788 0 788 0.0% 78.3 239 0 0.0% 32.0%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.02 17.02 96.20 96.20 0.0000 1.0000 132475.99 132475.99 0.00 1377.10 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.86 14.18% 954.55 955 955 800.87 0 955 1779 1779 0.00
multistrike 11.28 85.82% 477.28 477 477 477.28 477 477 5384 5384 0.00
hit 14.67 86.18% 1590.92 1591 1591 1590.92 1591 1591 23335 23335 0.00
crit 2.35 13.82% 3181.85 3182 3182 2888.99 0 3182 7485 7485 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 78.3 100.00% 238.64 239 239 238.64 239 239 18685 18685 0.00
hit 96.2 100.00% 788.04 1 795 788.28 762 795 75809 75809 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - water_elemental 2491 / 2491
water_jet 426 1.7% 10.0 30.39sec 12812 3000 Periodic 39.7 2264 4572 2602 14.7% 30.3 705 1429 15.3% 11.3%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.98 9.98 39.67 39.67 4.2709 0.8590 127917.35 127917.35 0.00 2999.87 2999.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.6 15.34% 1429.15 1303 1585 1420.84 0 1585 6636 6636 0.00
multistrike 25.6 84.66% 705.22 652 792 706.32 666 767 18070 18070 0.00
hit 33.9 85.34% 2263.56 2172 2641 2265.23 2195 2343 76626 76626 0.00
crit 5.8 14.66% 4572.24 4345 5283 4565.76 0 5283 26586 26586 0.00
 
DPS Timeline Chart
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$s1=0} damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.282000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
waterbolt 2065 8.5% 114.2 2.62sec 5429 2501 Direct 113.3 3851 7763 4390 13.8% 90.4 1185 2399 14.2%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.20 113.27 0.00 0.00 2.1710 0.0000 620012.92 620012.92 0.00 2500.86 2500.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.85 14.21% 2398.54 2242 2726 2400.57 2242 2726 30811 30811 0.00
multistrike 77.55 85.79% 1185.14 1121 1363 1185.91 1149 1237 91906 91906 0.00
hit 97.66 86.22% 3851.45 3736 4543 3853.32 3783 3929 376147 376147 0.00
crit 15.61 13.78% 7763.44 7472 9086 7768.73 7472 8817 121149 121149 0.00
 
DPS Timeline Chart
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals {$s1=511} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.485000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - mirror_image 9274 / 3449
frostbolt 9274 14.1% 201.8 4.06sec 5116 3134 Direct 200.8 3413 6927 4034 17.7% 177.6 1052 2149 18.2%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.77 200.80 0.00 0.00 1.6324 0.0000 1032207.77 1032207.77 0.00 3133.92 3133.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 32.30 18.19% 2148.60 1964 2389 2149.98 1989 2320 69392 69392 0.00
multistrike 145.28 81.81% 1052.23 982 1194 1052.92 1026 1101 152871 152871 0.00
hit 165.32 82.33% 3412.75 3274 3981 3414.99 3356 3512 564194 564194 0.00
crit 35.48 17.67% 6927.00 6548 7962 6933.33 6548 7636 245751 245751 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Procrank
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
icy_veins 2.1 181.34sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.05 2.05 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.79 87.35% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.26 12.65% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
 
water_elemental 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.89 88.68% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.11 11.32% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:4800.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to fight for the caster.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 24.3 5.6 12.2sec 9.9sec 19.47% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_brain_freeze
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:18.88%
  • brain_freeze_2:0.59%

Trigger Attempt Success

  • trigger_pct:29.02%

Spelldata details

  • id:57761
  • name:Brain Freeze
  • tooltip:Your next Frostfire Bolt costs no mana, is instant cast, acts as if your target were frozen, and deals {$44549s3=85}% additional damage.
  • description:{$@spelldesc44549=Your Frostbolts have a $m1% chance to cause the Brain Freeze effect. Each multistrike increases that cast's chance by an additional $m2%. The Brain Freeze effect causes your next Frostfire Bolt to cost no mana, be instant cast, deal {$s3=85}% additional damage, and act as if your target were frozen.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_intellect_potion 2.0 0.0 180.8sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enhanced_frostbolt 17.5 0.0 17.7sec 18.5sec 7.11% 16.85% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_enhanced_frostbolt
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_frostbolt_1:7.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157646
  • name:Enhanced Frostbolt
  • tooltip:
  • description:Frostbolt's cast time is reduced by 0.5 sec. This effect is disabled for {$157648d=15 seconds} after you benefit from it.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
fingers_of_frost 35.2 16.2 8.6sec 5.9sec 30.27% 100.00% 1.8(1.8)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • fingers_of_frost_1:25.97%
  • fingers_of_frost_2:4.30%

Trigger Attempt Success

  • trigger_pct:24.61%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance or Deep Freeze act as if your target were frozen and Ice Lance deals $w2% more damage.
  • description:{$@spelldesc112965=Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a {$s1=15}% chance, and your Blizzard ticks have a {$s2=5}% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by {$44544s2=100}%. Limit {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
icy_veins 2.1 0.0 180.8sec 181.4sec 22.60% 24.66% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • icy_veins_1:22.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
nightmare_fire 2.9 0.0 121.5sec 121.4sec 18.95% 18.97% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
frost_armor

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Multistrike increased by $7302w1%. Attackers are slowed.
  • description:Increases multistrike chance by {$s1=8}% and causes enemies who strike the caster to be slowed by {$7321s2=30}% for {$7321d=5 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Procrank
frostbolt Mana 103.7 663430.7 6400.0 6400.0 2.8
frozen_orb Mana 5.4 86749.0 16000.0 15999.8 2.8
ice_lance Mana 49.2 78723.9 1600.0 1600.0 16.8
mirror_image Mana 3.0 6406.9 2134.1 2134.1 161.1
Resource Gains Type Count Total Average Overflow
external_healing Health 8.76 0.00 (0.00%) 0.00 81018.09 100.00%
mp5_regen Mana 201.96 831742.08 (100.00%) 4118.35 167841.56 16.79%
Resource RPS-Gain RPS-Loss
Mana 2764.16 2776.02
Combat End Resource Mean Min Max
Mana 156348.72 138663.46 160000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
water_elemental 100.0%
water_elemental-water_elemental 100.0%
prismatic_crystal-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
Uptimes %
Mana Cap 21.4%
water_elemental-Mana Cap 21.4%
prismatic_crystal-Mana Cap 21.4%
mirror_image-Mana Cap 21.4%
mirror_image-Mana Cap 21.4%
mirror_image-Mana Cap 21.4%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Procrank Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Procrank Damage Per Second
Count 25000
Mean 24462.56
Minimum 21572.99
Maximum 27889.49
Spread ( max - min ) 6316.50
Range [ ( max - min ) / 2 * 100% ] 12.91%
Standard Deviation 899.4846
5th Percentile 22984.87
95th Percentile 25928.30
( 95th Percentile - 5th Percentile ) 2943.44
Mean Distribution
Standard Deviation 5.6888
95.00% Confidence Intervall ( 24451.41 - 24473.71 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5193
0.1 Scale Factor Error with Delta=300 6906
0.05 Scale Factor Error with Delta=300 27626
0.01 Scale Factor Error with Delta=300 690670
Distribution Chart
DPS(e)
Sample Data Procrank Damage Per Second (Effective)
Count 25000
Mean 24462.56
Minimum 21572.99
Maximum 27889.49
Spread ( max - min ) 6316.50
Range [ ( max - min ) / 2 * 100% ] 12.91%
Damage
Sample Data Procrank Damage
Count 25000
Mean 5557155.58
Minimum 4008911.80
Maximum 7137974.78
Spread ( max - min ) 3129062.98
Range [ ( max - min ) / 2 * 100% ] 28.15%
DTPS
Sample Data Procrank Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Procrank Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Procrank Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Procrank Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Procrank Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Procrank Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ProcrankTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Procrank Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 arcane_brilliance
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 mirror_image
7 0.00 potion,name=draenic_intellect
8 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
9 0.00 counterspell,if=target.debuff.casting.react
A 0.00 blink,if=movement.distance>10
B 0.00 blazing_speed,if=movement.remains>0
C 0.00 time_warp,if=target.health.pct<25|time>5
D 2.00 mirror_image
E 0.00 ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
F 0.00 rune_of_power,if=buff.rune_of_power.remains<cast_time
G 0.00 rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
H 0.00 call_action_list,name=cooldowns,if=time_to_die<24
I 0.00 call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
J 0.00 call_action_list,name=aoe,if=active_enemies>=4
K 0.00 call_action_list,name=single_target
actions.cooldowns
# count action,conditions
X 2.05 icy_veins
Consolidated damage cooldown abilities
Y 0.00 blood_fury
Z 0.00 berserking
a 0.00 arcane_torrent
b 1.00 potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up
actions.single_target
# count action,conditions
j 0.00 call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
Single target sequence
k 0.01 ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
Safeguards against losing FoF and BF to buff expiry
l 0.00 frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
m 0.00 frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
Frozen Orb usage without Prismatic Crystal
n 5.42 frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
o 0.00 frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
p 1.17 ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
q 21.81 ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
r 0.00 comet_storm
s 12.27 ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
t 29.67 frostfire_bolt,if=buff.brain_freeze.react
u 0.00 ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
v 0.00 ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
w 0.00 frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
Camp procs and spam Frostbolt while 4T17 buff is up
x 27.39 ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
y 10.01 water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
z 103.22 frostbolt
{ 0.00 ice_lance,moving=1

Sample Sequence

013678XnpqqszztqxyzzzttxzztzzxzszzzxzztyzzxxxzzztzszztzznqzzzzzttyzsxzzxtxzzzztxzztstxyzzqqxzzzzDnqqzszztqtxyzzzqxzzttzszzzztxyzzxtqxzzzzXbstnqqzzqzyzxzxzzstzzttxzzzzttyzzxsxzzzzzxDtnqqzqqsqyzzqxxzzzzxzzzzszyzzxxzzzztxzz

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana
Pre food Fluffy_Pillow 160000.0/160000: 100% mana
Pre water_elemental Fluffy_Pillow 160000.0/160000: 100% mana
Pre mirror_image Fluffy_Pillow 160000.0/160000: 100% mana
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 frostbolt Fluffy_Pillow 153600.0/160000: 96% mana draenic_intellect_potion
0:00.000 icy_veins Fluffy_Pillow 153600.0/160000: 96% mana draenic_intellect_potion
0:00.000 frozen_orb Fluffy_Pillow 153600.0/160000: 96% mana icy_veins, draenic_intellect_potion
0:01.352 ice_nova Fluffy_Pillow 143225.9/160000: 90% mana bloodlust, fingers_of_frost(2), icy_veins, draenic_intellect_potion
0:02.396 ice_lance Fluffy_Pillow 147570.2/160000: 92% mana bloodlust, fingers_of_frost(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:03.438 ice_lance Fluffy_Pillow 150306.1/160000: 94% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:04.482 ice_nova Fluffy_Pillow 153050.4/160000: 96% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:05.523 frostbolt Fluffy_Pillow 157382.2/160000: 98% mana bloodlust, icy_veins, enhanced_frostbolt, nightmare_fire, draenic_intellect_potion
0:06.566 frostbolt Fluffy_Pillow 155322.3/160000: 97% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:07.956 frostfire_bolt Fluffy_Pillow 154706.3/160000: 97% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:08.999 ice_lance Fluffy_Pillow 159046.4/160000: 99% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:10.042 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:11.085 water_jet Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:11.085 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:12.473 frostbolt Fluffy_Pillow 159375.7/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:13.863 frostbolt Fluffy_Pillow 158759.7/160000: 99% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:15.252 frostfire_bolt Fluffy_Pillow 158139.6/160000: 99% mana bloodlust, brain_freeze(2), fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:16.295 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:17.338 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:18.381 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:19.769 frostbolt Fluffy_Pillow 159375.7/160000: 100% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:21.157 frostfire_bolt Fluffy_Pillow 158751.4/160000: 99% mana bloodlust, brain_freeze, icy_veins, nightmare_fire
0:22.199 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, enhanced_frostbolt
0:23.241 frostbolt Fluffy_Pillow 157935.9/160000: 99% mana bloodlust, fingers_of_frost, icy_veins
0:24.629 ice_lance Fluffy_Pillow 157311.7/160000: 98% mana bloodlust, fingers_of_frost, icy_veins
0:25.671 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins
0:27.059 ice_nova Fluffy_Pillow 159375.7/160000: 100% mana bloodlust, icy_veins
0:28.102 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins
0:29.491 frostbolt Fluffy_Pillow 159379.9/160000: 100% mana bloodlust, icy_veins
0:30.881 frostbolt Fluffy_Pillow 158763.9/160000: 99% mana bloodlust, fingers_of_frost, icy_veins
0:32.269 ice_lance Fluffy_Pillow 158139.6/160000: 99% mana bloodlust, fingers_of_frost
0:33.312 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:34.701 frostbolt Fluffy_Pillow 159379.9/160000: 100% mana bloodlust, brain_freeze
0:36.090 frostfire_bolt Fluffy_Pillow 158759.7/160000: 99% mana bloodlust, brain_freeze
0:37.133 water_jet Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:37.133 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:38.523 frostbolt Fluffy_Pillow 159384.0/160000: 100% mana bloodlust, fingers_of_frost, enhanced_frostbolt
0:39.564 ice_lance Fluffy_Pillow 157315.8/160000: 98% mana bloodlust, fingers_of_frost(2)
0:40.608 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost(2)
0:41.652 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
0:43.005 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
0:44.809 frostbolt Fluffy_Pillow 159374.4/160000: 100% mana
0:46.611 frostbolt Fluffy_Pillow 158742.5/160000: 99% mana brain_freeze
0:48.416 frostfire_bolt Fluffy_Pillow 158120.1/160000: 99% mana brain_freeze
0:49.770 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
0:51.573 ice_nova Fluffy_Pillow 159371.2/160000: 100% mana
0:52.927 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
0:54.730 frostbolt Fluffy_Pillow 159371.2/160000: 100% mana brain_freeze, enhanced_frostbolt
0:56.082 frostfire_bolt Fluffy_Pillow 157298.9/160000: 98% mana brain_freeze
0:57.435 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
0:59.239 frostbolt Fluffy_Pillow 159374.4/160000: 100% mana
1:01.041 frozen_orb Fluffy_Pillow 158742.5/160000: 99% mana
1:02.393 ice_lance Fluffy_Pillow 147070.1/160000: 92% mana fingers_of_frost
1:03.745 frostbolt Fluffy_Pillow 149797.7/160000: 94% mana
1:05.550 frostbolt Fluffy_Pillow 149175.3/160000: 93% mana
1:07.356 frostbolt Fluffy_Pillow 148556.2/160000: 93% mana
1:09.161 frostbolt Fluffy_Pillow 147933.8/160000: 92% mana
1:10.965 frostbolt Fluffy_Pillow 147308.2/160000: 92% mana brain_freeze
1:12.770 frostfire_bolt Fluffy_Pillow 146685.9/160000: 92% mana brain_freeze(2)
1:14.123 frostfire_bolt Fluffy_Pillow 151016.7/160000: 94% mana brain_freeze
1:15.477 water_jet Fluffy_Pillow 155350.7/160000: 97% mana
1:15.477 frostbolt Fluffy_Pillow 155350.7/160000: 97% mana enhanced_frostbolt
1:16.832 ice_nova Fluffy_Pillow 153287.9/160000: 96% mana
1:18.185 ice_lance Fluffy_Pillow 157618.8/160000: 99% mana fingers_of_frost
1:19.539 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:21.343 frostbolt Fluffy_Pillow 159374.4/160000: 100% mana fingers_of_frost
1:23.147 ice_lance Fluffy_Pillow 158748.9/160000: 99% mana brain_freeze, fingers_of_frost
1:24.500 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze
1:25.854 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
1:27.208 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:29.011 frostbolt Fluffy_Pillow 159371.2/160000: 100% mana
1:30.814 frostbolt Fluffy_Pillow 158742.5/160000: 99% mana
1:32.619 frostbolt Fluffy_Pillow 158120.1/160000: 99% mana brain_freeze, enhanced_frostbolt
1:33.975 frostfire_bolt Fluffy_Pillow 156060.5/160000: 98% mana brain_freeze
1:35.329 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
1:36.682 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:38.486 frostbolt Fluffy_Pillow 159374.4/160000: 100% mana brain_freeze
1:40.290 frostfire_bolt Fluffy_Pillow 158748.9/160000: 99% mana brain_freeze(2)
1:41.642 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
1:42.994 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
1:44.347 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
1:45.701 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
1:45.701 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:47.503 frostbolt Fluffy_Pillow 159368.0/160000: 100% mana fingers_of_frost
1:49.308 ice_lance Fluffy_Pillow 158745.7/160000: 99% mana fingers_of_frost(2)
1:50.660 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2)
1:52.013 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
1:53.367 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
1:54.720 frostbolt Fluffy_Pillow 157930.8/160000: 99% mana
1:56.523 frostbolt Fluffy_Pillow 157302.1/160000: 98% mana
1:58.324 frostbolt Fluffy_Pillow 156666.9/160000: 98% mana
2:00.130 mirror_image Fluffy_Pillow 156047.7/160000: 98% mana
2:01.482 frozen_orb Fluffy_Pillow 157175.3/160000: 98% mana
2:02.837 ice_lance Fluffy_Pillow 145512.6/160000: 91% mana fingers_of_frost
2:04.191 ice_lance Fluffy_Pillow 148246.6/160000: 93% mana fingers_of_frost
2:05.546 frostbolt Fluffy_Pillow 150983.8/160000: 94% mana nightmare_fire
2:07.350 ice_nova Fluffy_Pillow 150358.2/160000: 94% mana nightmare_fire
2:08.702 frostbolt Fluffy_Pillow 154685.9/160000: 97% mana nightmare_fire
2:10.506 frostbolt Fluffy_Pillow 154060.3/160000: 96% mana brain_freeze, enhanced_frostbolt, nightmare_fire
2:11.860 frostfire_bolt Fluffy_Pillow 151994.3/160000: 95% mana brain_freeze(2), fingers_of_frost, nightmare_fire
2:13.213 ice_lance Fluffy_Pillow 156325.1/160000: 98% mana brain_freeze, fingers_of_frost(2), nightmare_fire
2:14.567 frostfire_bolt Fluffy_Pillow 159059.2/160000: 99% mana brain_freeze, fingers_of_frost, nightmare_fire
2:15.920 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, nightmare_fire
2:17.273 water_jet Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:17.273 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:19.077 frostbolt Fluffy_Pillow 159374.4/160000: 100% mana nightmare_fire
2:20.880 frostbolt Fluffy_Pillow 158745.7/160000: 99% mana fingers_of_frost, nightmare_fire
2:22.684 ice_lance Fluffy_Pillow 158120.1/160000: 99% mana fingers_of_frost(2), nightmare_fire
2:24.039 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, nightmare_fire
2:25.393 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:27.198 frostbolt Fluffy_Pillow 159377.6/160000: 100% mana brain_freeze, enhanced_frostbolt
2:28.552 frostfire_bolt Fluffy_Pillow 157311.7/160000: 98% mana brain_freeze(2)
2:29.905 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze
2:31.260 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:33.064 ice_nova Fluffy_Pillow 159374.4/160000: 100% mana
2:34.420 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:36.222 frostbolt Fluffy_Pillow 159368.0/160000: 100% mana
2:38.025 frostbolt Fluffy_Pillow 158739.3/160000: 99% mana
2:39.828 frostbolt Fluffy_Pillow 158110.5/160000: 99% mana brain_freeze, fingers_of_frost
2:41.632 frostfire_bolt Fluffy_Pillow 157484.9/160000: 98% mana brain_freeze, fingers_of_frost
2:42.986 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
2:44.338 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
2:44.338 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
2:45.692 frostbolt Fluffy_Pillow 157934.0/160000: 99% mana
2:47.496 ice_lance Fluffy_Pillow 157308.5/160000: 98% mana brain_freeze, fingers_of_frost
2:48.850 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
2:50.203 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2)
2:51.557 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
2:52.910 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:54.713 frostbolt Fluffy_Pillow 159371.2/160000: 100% mana
2:56.517 frostbolt Fluffy_Pillow 158745.7/160000: 99% mana
2:58.321 frostbolt Fluffy_Pillow 158120.1/160000: 99% mana brain_freeze
3:00.124 icy_veins Fluffy_Pillow 157491.3/160000: 98% mana brain_freeze
3:00.124 potion Fluffy_Pillow 157491.3/160000: 98% mana brain_freeze, icy_veins
3:00.124 ice_nova Fluffy_Pillow 157491.3/160000: 98% mana brain_freeze, icy_veins, draenic_intellect_potion
3:01.476 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, icy_veins, draenic_intellect_potion
3:02.831 frozen_orb Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, draenic_intellect_potion
3:04.185 ice_lance Fluffy_Pillow 148334.0/160000: 93% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:05.537 ice_lance Fluffy_Pillow 151061.6/160000: 94% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:06.889 frostbolt Fluffy_Pillow 153789.3/160000: 96% mana icy_veins, enhanced_frostbolt, draenic_intellect_potion
3:08.241 frostbolt Fluffy_Pillow 151716.9/160000: 95% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:10.043 ice_lance Fluffy_Pillow 151084.9/160000: 94% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:11.398 frostbolt Fluffy_Pillow 153822.1/160000: 96% mana icy_veins, draenic_intellect_potion
3:13.201 water_jet Fluffy_Pillow 153193.4/160000: 96% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:13.201 frostbolt Fluffy_Pillow 153193.4/160000: 96% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:15.004 ice_lance Fluffy_Pillow 152564.6/160000: 95% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:16.359 frostbolt Fluffy_Pillow 155301.8/160000: 97% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:18.162 ice_lance Fluffy_Pillow 154673.1/160000: 97% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:19.516 frostbolt Fluffy_Pillow 157407.1/160000: 98% mana icy_veins, draenic_intellect_potion
3:21.319 frostbolt Fluffy_Pillow 156778.3/160000: 98% mana icy_veins, draenic_intellect_potion
3:23.122 ice_nova Fluffy_Pillow 156149.5/160000: 98% mana brain_freeze, icy_veins, draenic_intellect_potion
3:24.476 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, icy_veins, draenic_intellect_potion
3:25.830 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, enhanced_frostbolt
3:27.182 frostbolt Fluffy_Pillow 157927.6/160000: 99% mana brain_freeze, fingers_of_frost, icy_veins
3:28.986 frostfire_bolt Fluffy_Pillow 157302.1/160000: 98% mana brain_freeze(2), fingers_of_frost, icy_veins
3:30.339 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
3:31.691 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:33.045 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
3:34.847 frostbolt Fluffy_Pillow 159368.0/160000: 100% mana
3:36.650 frostbolt Fluffy_Pillow 158739.3/160000: 99% mana
3:38.454 frostbolt Fluffy_Pillow 158113.7/160000: 99% mana brain_freeze
3:40.258 frostfire_bolt Fluffy_Pillow 157488.1/160000: 98% mana brain_freeze(2)
3:41.610 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze
3:42.964 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
3:42.964 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
3:44.319 frostbolt Fluffy_Pillow 157937.2/160000: 99% mana
3:46.121 ice_lance Fluffy_Pillow 157305.3/160000: 98% mana fingers_of_frost
3:47.475 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:48.828 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:50.181 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
3:51.986 frostbolt Fluffy_Pillow 159377.6/160000: 100% mana
3:53.789 frostbolt Fluffy_Pillow 158748.9/160000: 99% mana
3:55.592 frostbolt Fluffy_Pillow 158120.1/160000: 99% mana
3:57.396 frostbolt Fluffy_Pillow 157494.5/160000: 98% mana fingers_of_frost
3:59.201 ice_lance Fluffy_Pillow 156872.2/160000: 98% mana brain_freeze, fingers_of_frost
4:00.555 mirror_image Fluffy_Pillow 159606.2/160000: 100% mana brain_freeze
4:01.910 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze
4:03.264 frozen_orb Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
4:04.618 ice_lance Fluffy_Pillow 148334.0/160000: 93% mana fingers_of_frost(2), nightmare_fire
4:05.970 ice_lance Fluffy_Pillow 151061.6/160000: 94% mana fingers_of_frost, nightmare_fire
4:07.326 frostbolt Fluffy_Pillow 153802.1/160000: 96% mana fingers_of_frost, enhanced_frostbolt, nightmare_fire
4:08.679 ice_lance Fluffy_Pillow 151732.9/160000: 95% mana fingers_of_frost, nightmare_fire
4:10.032 ice_lance Fluffy_Pillow 154463.7/160000: 97% mana fingers_of_frost, nightmare_fire
4:11.385 ice_nova Fluffy_Pillow 157194.5/160000: 98% mana fingers_of_frost, nightmare_fire
4:12.738 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, nightmare_fire
4:14.093 water_jet Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:14.093 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:15.896 frostbolt Fluffy_Pillow 159371.2/160000: 100% mana fingers_of_frost, nightmare_fire
4:17.699 ice_lance Fluffy_Pillow 158742.5/160000: 99% mana fingers_of_frost(2), nightmare_fire
4:19.054 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2), nightmare_fire
4:20.406 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, nightmare_fire
4:21.761 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:23.565 frostbolt Fluffy_Pillow 159374.4/160000: 100% mana
4:25.367 frostbolt Fluffy_Pillow 158742.5/160000: 99% mana enhanced_frostbolt
4:26.722 frostbolt Fluffy_Pillow 156679.7/160000: 98% mana fingers_of_frost
4:28.525 ice_lance Fluffy_Pillow 156050.9/160000: 98% mana fingers_of_frost
4:29.880 frostbolt Fluffy_Pillow 158788.1/160000: 99% mana
4:31.682 frostbolt Fluffy_Pillow 158156.2/160000: 99% mana
4:33.486 frostbolt Fluffy_Pillow 157530.6/160000: 98% mana
4:35.289 frostbolt Fluffy_Pillow 156901.8/160000: 98% mana
4:37.093 ice_nova Fluffy_Pillow 156276.3/160000: 98% mana
4:38.446 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:40.250 water_jet Fluffy_Pillow 159374.4/160000: 100% mana
4:40.250 frostbolt Fluffy_Pillow 159374.4/160000: 100% mana
4:42.054 frostbolt Fluffy_Pillow 158748.9/160000: 99% mana enhanced_frostbolt
4:43.407 ice_lance Fluffy_Pillow 156679.7/160000: 98% mana fingers_of_frost
4:44.761 ice_lance Fluffy_Pillow 159413.7/160000: 100% mana fingers_of_frost
4:46.115 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:47.919 frostbolt Fluffy_Pillow 159374.4/160000: 100% mana
4:49.723 frostbolt Fluffy_Pillow 158748.9/160000: 99% mana
4:51.527 frostbolt Fluffy_Pillow 158123.3/160000: 99% mana brain_freeze
4:53.333 frostfire_bolt Fluffy_Pillow 157504.1/160000: 98% mana brain_freeze
4:54.688 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
4:56.042 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:57.845 frostbolt Fluffy_Pillow 159371.2/160000: 100% mana brain_freeze

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 748 713 713
Agility 998 951 951
Stamina 4206 3824 3824
Intellect 4048 3592 3477 (2315)
Spirit 1157 1157 1157
Health 252360 229440 0
Mana 160000 160000 0
Spell Power 5612 4646 1054
Crit 14.41% 9.41% 485
Haste 11.14% 5.85% 585
Multistrike 28.79% 14.20% 937
Damage / Heal Versatility 6.06% 3.06% 398
ManaReg per Second 3201 3048 0
Mastery 38.04% 28.04% 662
Armor 615 615 615
Run Speed 0 0 68

Talents

Level
15 Evanesce Blazing Speed Ice Floes
30 Alter Time Flameglow Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Frost Bomb (Frost Mage) Unstable Magic Ice Nova (Frost Mage)
90 Mirror Image Rune of Power Incanter's Flow
100 Thermal Void (Frost Mage) Prismatic Crystal Comet Storm (Frost Mage)

Profile

mage="Procrank"
origin="http://eu.battle.net/wow/en/character/forscherliga/Procrank/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/182/59746230-avatar.jpg"
level=100
race=draenei
role=spell
position=back
professions=tailoring=636/inscription=664
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eb!2201200
glyphs=icy_veins/water_elemental/splitting_ice/unbound_elemental/illusion/rapid_teleportation
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/arcane_brilliance
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/frostbolt

# Executed every time the actor is available.

actions=counterspell,if=target.debuff.casting.react
actions+=/blink,if=movement.distance>10
actions+=/blazing_speed,if=movement.remains>0
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/mirror_image
actions+=/ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
actions+=/rune_of_power,if=buff.rune_of_power.remains<cast_time
actions+=/rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
actions+=/call_action_list,name=cooldowns,if=time_to_die<24
actions+=/call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
actions+=/call_action_list,name=aoe,if=active_enemies>=4
actions+=/call_action_list,name=single_target

# Actions while Prismatic Crystal is active
actions.crystal_sequence=frost_bomb,if=active_enemies=1&current_target!=prismatic_crystal&remains<10
actions.crystal_sequence+=/frozen_orb
actions.crystal_sequence+=/call_action_list,name=cooldowns
actions.crystal_sequence+=/prismatic_crystal
actions.crystal_sequence+=/frost_bomb,if=talent.prismatic_crystal.enabled&current_target=prismatic_crystal&active_enemies>1&!ticking
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
actions.crystal_sequence+=/ice_nova,if=charges=2
actions.crystal_sequence+=/frostfire_bolt,if=buff.brain_freeze.react
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react
actions.crystal_sequence+=/ice_nova
actions.crystal_sequence+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2),if=active_enemies>=5
actions.crystal_sequence+=/frostbolt

# Consolidated damage cooldown abilities
actions.cooldowns=icy_veins
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up

# AoE sequence
actions.aoe=call_action_list,name=cooldowns
actions.aoe+=/frost_bomb,if=remains<action.ice_lance.travel_time&(cooldown.frozen_orb.remains<gcd.max|buff.fingers_of_frost.react=2)
actions.aoe+=/frozen_orb
actions.aoe+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.up
actions.aoe+=/comet_storm
actions.aoe+=/ice_nova
actions.aoe+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2)

# Single target sequence
actions.single_target=call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
# Safeguards against losing FoF and BF to buff expiry
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
# Frozen Orb usage without Prismatic Crystal
actions.single_target+=/frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
actions.single_target+=/frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
# Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
actions.single_target+=/frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
actions.single_target+=/ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
actions.single_target+=/comet_storm
actions.single_target+=/ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react
actions.single_target+=/ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
actions.single_target+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
# Camp procs and spam Frostbolt while 4T17 buff is up
actions.single_target+=/frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
actions.single_target+=/ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
actions.single_target+=/water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
actions.single_target+=/frostbolt
actions.single_target+=/ice_lance,moving=1

head=ironburner_cowl,id=118964,bonus_id=233
neck=whispering_taladite_pendant,id=115801,bonus_id=215/525/540,enchant=40mult
shoulders=felflame_spaulders,id=109948,bonus_id=523/524,gems=35mult
back=kyusys_tarflame_doomcloak,id=119346,bonus_id=42,enchant=gift_of_multistrike
chest=hexweave_robe,id=114813,bonus_id=166/525/537
shirt=sightless_mantle,id=98093
tabard=stormwind_tabard,id=118365
wrists=bracers_of_arcane_mystery,id=109864,bonus_id=524
hands=gloves_of_arcane_mystery,id=109844,bonus_id=523/524,gems=35mult
waist=cord_of_winsome_sorrows,id=119336,bonus_id=566
legs=seacursed_leggings,id=113828,bonus_id=566
feet=ironburner_sandals,id=118968,bonus_id=181
finger1=diamondglow_circle,id=109763,bonus_id=523/524,gems=35mult,enchant=30mult
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=30mult
trinket1=sandmans_pouch,id=112320,bonus_id=525/529
trinket2=grandiose_power,id=114550
main_hand=blackfire_spellblade,id=118984,bonus_id=220,enchant=mark_of_the_shattered_hand
off_hand=bileslingers_censer,id=113592,bonus_id=566

# Gear Summary
# gear_stamina=2934
# gear_intellect=2315
# gear_spell_power=1054
# gear_crit_rating=485
# gear_haste_rating=585
# gear_mastery_rating=662
# gear_armor=615
# gear_multistrike_rating=892
# gear_versatility_rating=398
# gear_speed_rating=68

Zentimeter

Zentimeter : 22056 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22055.8 22055.8 9.9 / 0.045% 3059.0 / 13.9% 6.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
2785.8 2785.8 Mana 0.00% 43.6 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Zentimeter/advanced
Talents
  • 15: Ice Floes
  • 30: Ice Barrier
  • 45: Ring of Frost
  • 60: Cauterize
  • 75: Ice Nova (Frost Mage)
  • 90: Mirror Image
  • 100: Thermal Void (Frost Mage)
  • Talent Calculator
Glyphs
  • Glyph of Icy Veins
  • Glyph of Splitting Ice
  • Glyph of Water Elemental
  • Glyph of Conjure Familiar
  • Glyph of Evaporation
  • Glyph of Momentum
Professions
  • tailoring: 670
  • enchanting: 655

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Zentimeter+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:324845|32847|31845|28961|18077|10032&chds=0,649691&chco=69CCF0,9900CC,0070DE,0070DE,0070DE,0070DE&chm=t++324845++mirror_image,69CCF0,0,0,15|t++32847++frostfire_bolt,9900CC,1,0,15|t++31845++ice_nova,0070DE,2,0,15|t++28961++frozen_orb,0070DE,3,0,15|t++18077++ice_lance,0070DE,4,0,15|t++10032++frostbolt,0070DE,5,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zentimeter+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:23,23,18,17,11,11,11,8,4,3,2&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,0070DE,0070DE,9900CC,0070DE,C79C6E,0070DE&chl=ice_lance|frostbolt|frostfire_bolt|mirror_image: frostbolt|water_elemental: waterbolt|icicle_fb|ice_nova|icicle_ffb|frozen_orb_bolt|shattered_bleed|water_elemental: water_jet&
http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Zentimeter+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:fiknrvx0256585245433201zywwvutttrqpnkihfeedcbaZXXVUTTTUUUVVVVVUUUUWXXXXXXWVVVUUUUTTTTTSRRRRSTUUUUUUVVVUUUUUUUUUTRRSSUVWXXYYZZaabccdeefeecbbaabccccbbbbbbbaaaaaaaZYXWVVVUUTVVVVWXYYZZabcdefghijijlllkjiiihhgffeedcbbZXWWWXYYXXWWWVVVUUUUUUTTTTTTUUWXYZZaabbcddeeeedddcbaaaabcccbbaaaaaaaaaZZYYXWUUUTUVUUUUUUUUUVVVVVVWWWVVVVVWWVVVUUUTTTTTTTSSSSTSRSSTUUUUUUUUUUUUTTTUUUVVUUUTTSRQPONMM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.468874,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=22056|max=47040&chxp=1,1,47,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Zentimeter+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,3,6,20,33,51,62,125,176,271,312,438,541,655,823,900,950,1053,1140,1222,1269,1289,1345,1289,1344,1261,1196,1085,1058,973,837,709,586,481,388,314,224,159,121,100,64,51,26,21,6,4,6,6,1,4&chds=0,1345&chbh=5&chxt=x&chxl=0:|min=19476|avg=22056|max=25106&chxp=0,1,46,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zentimeter+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:56.4,21.3,13.3,5.7,2.4,0.9&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,69CCF0&chl=frostbolt 169.8s|ice_lance 64.0s|frostfire_bolt 39.9s|ice_nova 17.1s|frozen_orb 7.3s|mirror_image 2.7s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Zentimeter 22056
frostbolt 3834 (5669) 17.4% (25.7%) 104.0 2.86sec 16383 10032 Direct 103.7 8192 16387 8882 8.4% 84.8 2512 5024 8.4%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.97 103.72 0.00 0.00 1.6331 0.0000 1152175.06 1152175.06 0.00 10031.75 10031.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.13 8.41% 5024.32 4778 5913 5024.65 0 5913 35843 35843 0.00
multistrike 77.65 91.59% 2512.12 2389 2957 2513.76 2427 2618 195058 195058 0.00
hit 94.99 91.58% 8191.99 7963 9856 8195.92 8039 8367 778163 778163 0.00
crit 8.73 8.42% 16386.99 15927 19711 16391.21 0 19711 143111 143111 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%.]
  • description:Launches a bolt of frost at the enemy, causing {$s2=1140} Frost damage and slowing movement speed by {$s1=50}% for {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.191000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    icicle_fb 1835 8.3% 186.4 1.94sec 2957 0 Direct 185.3 2975 0 2975 0.0% 0.0 0 0 0.0%  

Stats details: icicle_fb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 186.40 185.28 0.00 0.00 0.0000 0.0000 551125.98 551125.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.28 100.00% 2974.55 1101 15219 2976.32 2333 3887 551126 551126 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1760.65
  • base_dd_max:1760.65
 
frostfire_bolt 3043 (4375) 13.8% (19.8%) 31.4 9.33sec 41740 32847 Direct 31.3 13920 27837 22653 62.8% 29.0 4291 8582 62.5%  

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.41 31.34 0.00 0.00 1.2708 0.0000 911953.33 911953.33 0.00 32846.92 32846.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 18.11 62.54% 8582.40 8003 9905 8588.77 8003 9905 155423 155423 0.00
multistrike 10.85 37.46% 4291.49 4001 4952 4295.10 4001 4952 46552 46552 0.00
hit 11.67 37.25% 13920.31 13338 16508 13929.08 13338 16508 162497 162497 0.00
crit 19.67 62.75% 27836.74 26677 33017 27857.13 26677 30711 547481 547481 0.00
 
DPS Timeline Chart
 

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by {$s1=40}%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][{$s2=1516}] Frostfire damage and slowing the target's movement by {$s1=40}% for {$d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.586000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    icicle_ffb 1332 6.0% 59.7 5.17sec 6685 0 Direct 59.4 6718 0 6718 0.0% 0.0 0 0 0.0%  

Stats details: icicle_ffb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.69 59.39 0.00 0.00 0.0000 0.0000 399033.07 399033.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.39 100.00% 6718.44 1101 15219 6728.09 4725 8790 399033 399033 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1760.65
  • base_dd_max:1760.65
 
frozen_orb 0 (704) 0.0% (3.2%) 5.4 60.95sec 38760 28961

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.44 5.44 53.28 53.28 1.3385 1.0000 0.00 0.00 0.00 3480.34 28960.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.8 91.60% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.5 8.40% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16000.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=367} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    frozen_orb_bolt 704 3.2% 0.0 0.00sec 0 0 Direct 53.3 2792 5582 3027 8.4% 52.1 877 1754 8.4%  

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 53.28 0.00 0.00 0.0000 0.0000 210748.43 210748.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.35 8.36% 1754.11 1538 1903 1734.15 0 1903 7639 7639 0.00
multistrike 47.71 91.64% 876.96 769 952 878.12 836 933 41844 41844 0.00
hit 48.79 91.58% 2792.09 2563 3172 2795.80 2716 2922 136234 136234 0.00
crit 4.48 8.42% 5582.23 5127 6345 5527.21 0 6345 25032 25032 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=30}%.
  • description:{$@spelldesc84714=Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=367} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.383250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
ice_lance 3854 17.5% 49.7 6.03sec 23285 18077 Direct 49.5 11270 22539 18318 62.5% 43.8 3507 7018 62.6%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.68 49.51 0.00 0.00 1.2881 0.0000 1156679.61 1156679.61 0.00 18076.79 18076.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.41 62.61% 7017.77 6418 7943 7025.31 6545 7816 192356 192356 0.00
multistrike 16.37 37.39% 3507.16 3209 3972 3511.03 3209 3972 57414 57414 0.00
hit 18.55 37.46% 11270.35 10696 13239 11280.30 10696 12545 209011 209011 0.00
crit 30.96 62.54% 22539.22 21393 26477 22558.54 21393 24359 697899 697899 0.00
 
DPS Timeline Chart
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Deals $?a44544[${$m1*$<fingersMult>} to ${$M1*$<fingersMult>}][{$s1=382}] Frost damage to an enemy target{$?s56377=true}&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]{$?s56377=true}&a44544[, and ${$m1*$<fingersMult>*$56377m2/100} to ${$M1*$<fingersMult>*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is doubled against frozen targets. Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
ice_nova 1814 8.2% 13.4 23.09sec 40434 31845 Direct 13.4 28634 57271 31053 8.4% 13.0 8922 17844 8.4%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.45 13.45 0.00 0.00 1.2698 0.0000 543719.75 543719.75 0.00 31844.90 31844.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.10 8.43% 17844.50 16046 19859 12031.13 0 19859 19611 19611 0.00
multistrike 11.94 91.57% 8922.50 8023 9930 8941.26 8023 9930 106533 106533 0.00
hit 12.31 91.55% 28633.82 26744 33099 28661.69 26744 30980 352505 352505 0.00
crit 1.14 8.45% 57270.69 53487 66198 39581.50 0 66198 65070 65070 0.00
 
DPS Timeline Chart
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=1913} Frost damage to all enemies within $A2 yards, and freezing for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage. Max 2 charges. Replaces Frost Nova.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mirror_image 0 (2909) 0.0% (13.2%) 3.0 120.98sec 289952 324845

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.8927 0.0000 0.00 0.00 0.00 324845.46 324845.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.76 91.80% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.25 8.20% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:
  • description:Creates {$s2=3} copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=40 seconds}.
 
    frostbolt (mirror_image) 7821 13.2% 201.9 4.06sec 4312 2671 Direct 200.9 3088 6176 3347 8.4% 191.6 953 1906 8.4%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.90 200.92 0.00 0.00 1.6145 0.0000 870585.83 870585.83 0.00 2670.78 2670.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.13 8.42% 1906.09 1765 2184 1907.38 1765 2184 30748 30748 0.00
multistrike 175.50 91.58% 953.16 882 1092 953.81 931 992 167280 167280 0.00
hit 184.02 91.59% 3087.62 2941 3641 3089.98 3050 3161 568170 568170 0.00
crit 16.90 8.41% 6175.68 5883 7281 6180.18 5883 7002 104388 104388 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
shattered_bleed 441 2.0% 17.2 17.86sec 7691 0 Direct 17.2 1571 3143 1703 8.4% 14.3 471 943 8.5%  
Periodic 97.2 778 0 778 0.0% 85.1 236 0 0.0% 32.3%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.20 17.20 97.16 97.16 0.0000 1.0000 132304.26 132304.26 0.00 1361.67 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.21 8.46% 942.85 943 943 655.51 0 943 1143 1143 0.00
multistrike 13.13 91.54% 471.43 471 471 471.43 471 471 6189 6189 0.00
hit 15.76 91.62% 1571.42 1571 1571 1571.42 1571 1571 24765 24765 0.00
crit 1.44 8.38% 3142.85 3143 3143 2420.24 0 3143 4533 4533 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 85.1 100.00% 235.71 236 236 235.71 236 236 20067 20067 0.00
hit 97.2 100.00% 778.14 1 786 778.37 752 786 75607 75607 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - water_elemental 2290 / 2290
water_jet 384 1.7% 10.0 30.31sec 11547 2732 Periodic 39.7 2133 4269 2312 8.4% 32.7 665 1331 8.4% 11.2%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 10.00 39.73 39.73 4.2262 0.8500 115456.95 115456.95 0.00 2732.19 2732.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.7 8.40% 1331.16 1222 1512 1249.10 0 1512 3659 3659 0.00
multistrike 30.0 91.60% 665.37 611 756 666.49 627 720 19936 19936 0.00
hit 36.4 91.62% 2133.39 2036 2520 2135.23 2067 2204 77656 77656 0.00
crit 3.3 8.38% 4268.59 4072 5040 4122.03 0 5040 14206 14206 0.00
 
DPS Timeline Chart
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$s1=0} damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.282000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
waterbolt 1906 8.6% 116.0 2.58sec 4935 2299 Direct 115.0 3627 7253 3931 8.4% 99.1 1117 2234 8.4%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.96 115.02 0.00 0.00 2.1466 0.0000 572220.94 572220.94 0.00 2298.80 2298.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.30 8.38% 2234.42 2101 2600 2235.58 0 2600 18553 18553 0.00
multistrike 90.84 91.62% 1117.39 1051 1300 1118.19 1082 1163 101499 101499 0.00
hit 105.35 91.60% 3626.71 3502 4334 3628.76 3569 3695 382090 382090 0.00
crit 9.66 8.40% 7252.58 7003 8668 7254.10 0 8668 70078 70078 0.00
 
DPS Timeline Chart
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals {$s1=464} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.485000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - mirror_image 7821 / 2909
frostbolt 7821 13.2% 201.9 4.06sec 4312 2671 Direct 200.9 3088 6176 3347 8.4% 191.6 953 1906 8.4%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.90 200.92 0.00 0.00 1.6145 0.0000 870585.83 870585.83 0.00 2670.78 2670.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.13 8.42% 1906.09 1765 2184 1907.38 1765 2184 30748 30748 0.00
multistrike 175.50 91.58% 953.16 882 1092 953.81 931 992 167280 167280 0.00
hit 184.02 91.59% 3087.62 2941 3641 3089.98 3050 3161 568170 568170 0.00
crit 16.90 8.41% 6175.68 5883 7281 6180.18 5883 7002 104388 104388 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Zentimeter
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
icy_veins 2.1 181.15sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 2.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.89 91.92% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.17 8.08% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
 
water_elemental 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.92 91.60% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.08 8.40% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:4800.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to fight for the caster.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 25.5 6.2 11.7sec 9.3sec 20.46% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_brain_freeze
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:19.78%
  • brain_freeze_2:0.68%

Trigger Attempt Success

  • trigger_pct:30.62%

Spelldata details

  • id:57761
  • name:Brain Freeze
  • tooltip:Your next Frostfire Bolt costs no mana, is instant cast, acts as if your target were frozen, and deals {$44549s3=85}% additional damage.
  • description:{$@spelldesc44549=Your Frostbolts have a $m1% chance to cause the Brain Freeze effect. Each multistrike increases that cast's chance by an additional $m2%. The Brain Freeze effect causes your next Frostfire Bolt to cost no mana, be instant cast, deal {$s3=85}% additional damage, and act as if your target were frozen.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_intellect_potion 2.0 0.0 180.8sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enhanced_frostbolt 17.7 0.0 17.5sec 18.2sec 7.11% 16.97% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_enhanced_frostbolt
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_frostbolt_1:7.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157646
  • name:Enhanced Frostbolt
  • tooltip:
  • description:Frostbolt's cast time is reduced by 0.5 sec. This effect is disabled for {$157648d=15 seconds} after you benefit from it.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
fingers_of_frost 35.3 16.7 8.6sec 5.8sec 30.52% 100.00% 1.9(1.9)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • fingers_of_frost_1:26.10%
  • fingers_of_frost_2:4.42%

Trigger Attempt Success

  • trigger_pct:24.61%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance or Deep Freeze act as if your target were frozen and Ice Lance deals $w2% more damage.
  • description:{$@spelldesc112965=Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a {$s1=15}% chance, and your Blizzard ticks have a {$s2=5}% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by {$44544s2=100}%. Limit {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
icy_veins 2.1 0.0 180.8sec 181.1sec 22.75% 24.84% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • icy_veins_1:22.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
frost_armor

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Multistrike increased by $7302w1%. Attackers are slowed.
  • description:Increases multistrike chance by {$s1=8}% and causes enemies who strike the caster to be slowed by {$7321s2=30}% for {$7321d=5 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zentimeter
frostbolt Mana 104.0 665385.5 6400.0 6400.0 2.6
frozen_orb Mana 5.4 86994.1 16000.0 15999.8 2.4
ice_lance Mana 49.7 79481.4 1600.0 1600.0 14.6
mirror_image Mana 3.0 6408.1 2134.2 2134.2 135.9
Resource Gains Type Count Total Average Overflow
external_healing Health 8.72 0.00 (0.00%) 0.00 80542.36 100.00%
mp5_regen Mana 204.49 834742.49 (100.00%) 4082.11 175791.74 17.40%
Resource RPS-Gain RPS-Loss
Mana 2774.12 2785.84
Combat End Resource Mean Min Max
Mana 164464.64 146658.66 168000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
water_elemental 100.0%
water_elemental-water_elemental 100.0%
prismatic_crystal-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
Uptimes %
Mana Cap 21.9%
water_elemental-Mana Cap 21.9%
prismatic_crystal-Mana Cap 21.9%
mirror_image-Mana Cap 21.9%
mirror_image-Mana Cap 21.9%
mirror_image-Mana Cap 21.9%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Zentimeter Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Zentimeter Damage Per Second
Count 25000
Mean 22055.78
Minimum 19476.15
Maximum 25105.64
Spread ( max - min ) 5629.49
Range [ ( max - min ) / 2 * 100% ] 12.76%
Standard Deviation 797.3347
5th Percentile 20766.45
95th Percentile 23371.00
( 95th Percentile - 5th Percentile ) 2604.55
Mean Distribution
Standard Deviation 5.0428
95.00% Confidence Intervall ( 22045.90 - 22065.66 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5020
0.1 Scale Factor Error with Delta=300 5427
0.05 Scale Factor Error with Delta=300 21708
0.01 Scale Factor Error with Delta=300 542706
Distribution Chart
DPS(e)
Sample Data Zentimeter Damage Per Second (Effective)
Count 25000
Mean 22055.78
Minimum 19476.15
Maximum 25105.64
Spread ( max - min ) 5629.49
Range [ ( max - min ) / 2 * 100% ] 12.76%
Damage
Sample Data Zentimeter Damage
Count 25000
Mean 5057739.50
Minimum 3615892.23
Maximum 6585273.41
Spread ( max - min ) 2969381.18
Range [ ( max - min ) / 2 * 100% ] 29.35%
DTPS
Sample Data Zentimeter Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zentimeter Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Zentimeter Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zentimeter Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zentimeter Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zentimeter Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ZentimeterTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Zentimeter Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 arcane_brilliance
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 mirror_image
7 0.00 potion,name=draenic_intellect
8 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
9 0.00 counterspell,if=target.debuff.casting.react
A 0.00 blink,if=movement.distance>10
B 0.00 blazing_speed,if=movement.remains>0
C 0.00 time_warp,if=target.health.pct<25|time>5
D 2.00 mirror_image
E 0.00 ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
F 0.00 rune_of_power,if=buff.rune_of_power.remains<cast_time
G 0.00 rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
H 0.00 call_action_list,name=cooldowns,if=time_to_die<24
I 0.00 call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
J 0.00 call_action_list,name=aoe,if=active_enemies>=4
K 0.00 call_action_list,name=single_target
actions.cooldowns
# count action,conditions
X 2.06 icy_veins
Consolidated damage cooldown abilities
Y 0.00 blood_fury
Z 0.00 berserking
a 0.00 arcane_torrent
b 1.00 potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up
actions.single_target
# count action,conditions
j 0.00 call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
Single target sequence
k 0.00 ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
Safeguards against losing FoF and BF to buff expiry
l 0.00 frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
m 0.00 frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
Frozen Orb usage without Prismatic Crystal
n 5.44 frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
o 0.00 frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
p 1.17 ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
q 22.21 ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
r 0.00 comet_storm
s 12.27 ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
t 31.41 frostfire_bolt,if=buff.brain_freeze.react
u 0.00 ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
v 0.00 ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
w 0.00 frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
Camp procs and spam Frostbolt while 4T17 buff is up
x 27.47 ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
y 10.02 water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
z 103.52 frostbolt
{ 0.00 ice_lance,moving=1

Sample Sequence

013678XnpqszzttzxtyzzxtqxzzzttxzstzzttzztyzzxxxzzttzsztzzznqttqqzzyzzxsxzzzzzzzzzzxtqsxyzzxzxzzttzDtnqzqszqqxyzzxzxtxzzxzszzzzzyzzttqxzzzztzXbsxnqzzzzttxyzztqstxzzzztzxxzzyzzsqtxzzztqxDznqtzzstyzzxzxxzzzttxzztszzyzzxxzzzzzz

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 168000.0/168000: 100% mana
Pre food Fluffy_Pillow 168000.0/168000: 100% mana
Pre water_elemental Fluffy_Pillow 168000.0/168000: 100% mana
Pre mirror_image Fluffy_Pillow 168000.0/168000: 100% mana
Pre potion Fluffy_Pillow 168000.0/168000: 100% mana draenic_intellect_potion
0:00.000 frostbolt Fluffy_Pillow 161600.0/168000: 96% mana draenic_intellect_potion
0:00.000 icy_veins Fluffy_Pillow 161600.0/168000: 96% mana draenic_intellect_potion
0:00.000 frozen_orb Fluffy_Pillow 161600.0/168000: 96% mana icy_veins, draenic_intellect_potion
0:01.340 ice_nova Fluffy_Pillow 151237.6/168000: 90% mana bloodlust, fingers_of_frost, icy_veins, draenic_intellect_potion
0:02.371 ice_lance Fluffy_Pillow 155575.2/168000: 93% mana bloodlust, fingers_of_frost, icy_veins, draenic_intellect_potion
0:03.401 ice_nova Fluffy_Pillow 158308.5/168000: 94% mana bloodlust, icy_veins, draenic_intellect_potion
0:04.432 frostbolt Fluffy_Pillow 162646.1/168000: 97% mana bloodlust, icy_veins, enhanced_frostbolt, draenic_intellect_potion
0:05.463 frostbolt Fluffy_Pillow 160583.7/168000: 96% mana bloodlust, brain_freeze, icy_veins, draenic_intellect_potion
0:06.839 frostfire_bolt Fluffy_Pillow 159972.7/168000: 95% mana bloodlust, brain_freeze(2), icy_veins, draenic_intellect_potion
0:07.869 frostfire_bolt Fluffy_Pillow 164306.1/168000: 98% mana bloodlust, brain_freeze, icy_veins, draenic_intellect_potion
0:08.901 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, draenic_intellect_potion
0:10.275 ice_lance Fluffy_Pillow 167380.6/168000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
0:11.307 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, icy_veins, draenic_intellect_potion
0:12.340 water_jet Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, draenic_intellect_potion
0:12.340 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, draenic_intellect_potion
0:13.715 frostbolt Fluffy_Pillow 167384.8/168000: 100% mana bloodlust, icy_veins, draenic_intellect_potion
0:15.090 ice_lance Fluffy_Pillow 166769.7/168000: 99% mana bloodlust, brain_freeze, fingers_of_frost(2), icy_veins, draenic_intellect_potion
0:16.121 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
0:17.150 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost(2), icy_veins, draenic_intellect_potion
0:18.182 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, draenic_intellect_potion
0:19.213 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, draenic_intellect_potion
0:20.587 frostbolt Fluffy_Pillow 167380.6/168000: 100% mana bloodlust, icy_veins, enhanced_frostbolt
0:21.620 frostbolt Fluffy_Pillow 165326.6/168000: 98% mana bloodlust, brain_freeze, icy_veins
0:22.994 frostfire_bolt Fluffy_Pillow 164707.3/168000: 98% mana bloodlust, brain_freeze(2), icy_veins
0:24.024 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, icy_veins
0:25.054 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins
0:26.086 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins
0:27.461 ice_nova Fluffy_Pillow 167384.8/168000: 100% mana bloodlust, brain_freeze, icy_veins
0:28.492 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, icy_veins
0:29.524 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins
0:30.898 frostbolt Fluffy_Pillow 167380.6/168000: 100% mana bloodlust, brain_freeze, icy_veins
0:32.272 frostfire_bolt Fluffy_Pillow 166761.3/168000: 99% mana bloodlust, brain_freeze(2)
0:33.303 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze
0:34.334 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust
0:35.706 frostbolt Fluffy_Pillow 167372.2/168000: 100% mana bloodlust, brain_freeze
0:37.079 frostfire_bolt Fluffy_Pillow 166748.6/168000: 99% mana bloodlust, brain_freeze
0:38.108 water_jet Fluffy_Pillow 168000.0/168000: 100% mana bloodlust
0:38.108 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, enhanced_frostbolt
0:39.137 frostbolt Fluffy_Pillow 165929.2/168000: 99% mana bloodlust, fingers_of_frost
0:40.510 ice_lance Fluffy_Pillow 165305.6/168000: 98% mana bloodlust, fingers_of_frost(2)
0:41.541 ice_lance Fluffy_Pillow 167042.2/168000: 99% mana fingers_of_frost(2)
0:42.880 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
0:44.218 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
0:46.001 frostbolt Fluffy_Pillow 167370.3/168000: 100% mana brain_freeze
0:47.784 frostfire_bolt Fluffy_Pillow 166740.5/168000: 99% mana brain_freeze(2)
0:49.123 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
0:50.460 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
0:52.244 ice_nova Fluffy_Pillow 167373.5/168000: 100% mana brain_freeze
0:53.583 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
0:55.368 frostfire_bolt Fluffy_Pillow 167376.7/168000: 100% mana brain_freeze
0:56.705 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt
0:58.042 frostbolt Fluffy_Pillow 165926.9/168000: 99% mana
0:59.824 frostbolt Fluffy_Pillow 165293.9/168000: 98% mana brain_freeze
1:01.609 frozen_orb Fluffy_Pillow 164670.7/168000: 98% mana brain_freeze(2)
1:02.947 ice_lance Fluffy_Pillow 153000.8/168000: 91% mana brain_freeze(2), fingers_of_frost
1:04.284 frostfire_bolt Fluffy_Pillow 155727.7/168000: 93% mana brain_freeze(2)
1:05.623 frostfire_bolt Fluffy_Pillow 160061.1/168000: 95% mana brain_freeze, fingers_of_frost
1:06.961 ice_lance Fluffy_Pillow 164391.2/168000: 98% mana fingers_of_frost(2)
1:08.300 ice_lance Fluffy_Pillow 167124.6/168000: 99% mana fingers_of_frost
1:09.638 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:11.422 frostbolt Fluffy_Pillow 167373.5/168000: 100% mana
1:13.205 water_jet Fluffy_Pillow 166743.8/168000: 99% mana
1:13.205 frostbolt Fluffy_Pillow 166743.8/168000: 99% mana enhanced_frostbolt
1:14.543 frostbolt Fluffy_Pillow 164673.9/168000: 98% mana
1:16.326 ice_lance Fluffy_Pillow 164044.2/168000: 98% mana fingers_of_frost
1:17.664 ice_nova Fluffy_Pillow 166774.3/168000: 99% mana fingers_of_frost
1:19.003 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
1:20.344 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:22.127 frostbolt Fluffy_Pillow 167370.3/168000: 100% mana
1:23.910 frostbolt Fluffy_Pillow 166740.5/168000: 99% mana
1:25.694 frostbolt Fluffy_Pillow 166114.1/168000: 99% mana
1:27.477 frostbolt Fluffy_Pillow 165484.3/168000: 99% mana
1:29.260 frostbolt Fluffy_Pillow 164854.6/168000: 98% mana
1:31.045 frostbolt Fluffy_Pillow 164231.4/168000: 98% mana enhanced_frostbolt
1:32.384 frostbolt Fluffy_Pillow 162164.7/168000: 97% mana
1:34.167 frostbolt Fluffy_Pillow 161535.0/168000: 96% mana
1:35.951 frostbolt Fluffy_Pillow 160908.5/168000: 96% mana fingers_of_frost
1:37.734 ice_lance Fluffy_Pillow 160278.8/168000: 95% mana brain_freeze, fingers_of_frost(2)
1:39.072 frostfire_bolt Fluffy_Pillow 163008.9/168000: 97% mana brain_freeze, fingers_of_frost
1:40.411 ice_lance Fluffy_Pillow 167342.3/168000: 100% mana fingers_of_frost(2)
1:41.750 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
1:43.089 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
1:44.428 water_jet Fluffy_Pillow 168000.0/168000: 100% mana
1:44.428 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:46.213 frostbolt Fluffy_Pillow 167376.7/168000: 100% mana
1:47.995 ice_lance Fluffy_Pillow 166743.8/168000: 99% mana fingers_of_frost
1:49.333 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, enhanced_frostbolt
1:50.671 ice_lance Fluffy_Pillow 165930.1/168000: 99% mana fingers_of_frost
1:52.011 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:53.794 frostbolt Fluffy_Pillow 167370.3/168000: 100% mana brain_freeze
1:55.576 frostfire_bolt Fluffy_Pillow 166737.3/168000: 99% mana brain_freeze(2)
1:56.915 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
1:58.254 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:00.037 mirror_image Fluffy_Pillow 167370.3/168000: 100% mana brain_freeze
2:01.376 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
2:02.713 frozen_orb Fluffy_Pillow 168000.0/168000: 100% mana
2:04.051 ice_lance Fluffy_Pillow 156330.1/168000: 93% mana fingers_of_frost
2:05.390 frostbolt Fluffy_Pillow 159063.5/168000: 95% mana
2:07.174 ice_lance Fluffy_Pillow 158437.0/168000: 94% mana fingers_of_frost
2:08.512 ice_nova Fluffy_Pillow 161167.1/168000: 96% mana
2:09.852 frostbolt Fluffy_Pillow 165503.8/168000: 99% mana fingers_of_frost, enhanced_frostbolt
2:11.192 ice_lance Fluffy_Pillow 163440.4/168000: 97% mana fingers_of_frost
2:12.531 ice_lance Fluffy_Pillow 166173.7/168000: 99% mana fingers_of_frost
2:13.868 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:15.208 water_jet Fluffy_Pillow 168000.0/168000: 100% mana
2:15.208 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:16.991 frostbolt Fluffy_Pillow 167370.3/168000: 100% mana
2:18.774 ice_lance Fluffy_Pillow 166740.5/168000: 99% mana fingers_of_frost
2:20.112 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:21.896 ice_lance Fluffy_Pillow 167373.5/168000: 100% mana brain_freeze, fingers_of_frost(2)
2:23.233 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost
2:24.572 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:25.910 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:27.694 frostbolt Fluffy_Pillow 167373.5/168000: 100% mana fingers_of_frost, enhanced_frostbolt
2:29.032 ice_lance Fluffy_Pillow 165303.6/168000: 98% mana fingers_of_frost
2:30.371 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:32.154 ice_nova Fluffy_Pillow 167370.3/168000: 100% mana
2:33.493 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:35.277 frostbolt Fluffy_Pillow 167373.5/168000: 100% mana
2:37.059 frostbolt Fluffy_Pillow 166740.5/168000: 99% mana
2:38.843 frostbolt Fluffy_Pillow 166114.1/168000: 99% mana
2:40.627 frostbolt Fluffy_Pillow 165487.6/168000: 99% mana
2:42.410 water_jet Fluffy_Pillow 164857.8/168000: 98% mana
2:42.410 frostbolt Fluffy_Pillow 164857.8/168000: 98% mana
2:44.193 frostbolt Fluffy_Pillow 164228.1/168000: 98% mana brain_freeze, enhanced_frostbolt
2:45.531 frostfire_bolt Fluffy_Pillow 162158.3/168000: 97% mana brain_freeze(2), fingers_of_frost
2:46.869 frostfire_bolt Fluffy_Pillow 166488.4/168000: 99% mana brain_freeze, fingers_of_frost(2)
2:48.208 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
2:49.545 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:50.884 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:52.666 frostbolt Fluffy_Pillow 167367.0/168000: 100% mana
2:54.449 frostbolt Fluffy_Pillow 166737.3/168000: 99% mana
2:56.231 frostbolt Fluffy_Pillow 166104.4/168000: 99% mana brain_freeze
2:58.014 frostfire_bolt Fluffy_Pillow 165474.6/168000: 98% mana brain_freeze, fingers_of_frost
2:59.353 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
3:01.137 icy_veins Fluffy_Pillow 167373.5/168000: 100% mana fingers_of_frost
3:01.137 potion Fluffy_Pillow 167373.5/168000: 100% mana fingers_of_frost, icy_veins
3:01.137 ice_nova Fluffy_Pillow 167373.5/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:02.476 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:03.813 frozen_orb Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:05.152 ice_lance Fluffy_Pillow 156333.4/168000: 93% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:06.488 frostbolt Fluffy_Pillow 159057.0/168000: 95% mana icy_veins, enhanced_frostbolt, draenic_intellect_potion
3:07.824 frostbolt Fluffy_Pillow 156980.7/168000: 93% mana icy_veins, draenic_intellect_potion
3:09.606 frostbolt Fluffy_Pillow 156347.7/168000: 93% mana icy_veins, draenic_intellect_potion
3:11.390 frostbolt Fluffy_Pillow 155721.2/168000: 93% mana brain_freeze, icy_veins, draenic_intellect_potion
3:13.171 frostfire_bolt Fluffy_Pillow 155085.0/168000: 92% mana brain_freeze(2), fingers_of_frost, icy_veins, draenic_intellect_potion
3:14.509 frostfire_bolt Fluffy_Pillow 159415.2/168000: 95% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:15.846 ice_lance Fluffy_Pillow 163742.1/168000: 97% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:17.186 water_jet Fluffy_Pillow 166478.7/168000: 99% mana icy_veins, draenic_intellect_potion
3:17.186 frostbolt Fluffy_Pillow 166478.7/168000: 99% mana icy_veins, draenic_intellect_potion
3:18.969 frostbolt Fluffy_Pillow 165848.9/168000: 99% mana brain_freeze, icy_veins, draenic_intellect_potion
3:20.753 frostfire_bolt Fluffy_Pillow 165222.5/168000: 98% mana brain_freeze(2), fingers_of_frost, icy_veins, draenic_intellect_potion
3:22.090 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:23.429 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:24.767 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:26.105 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:27.444 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, enhanced_frostbolt
3:28.783 frostbolt Fluffy_Pillow 165933.4/168000: 99% mana icy_veins
3:30.566 frostbolt Fluffy_Pillow 165303.6/168000: 98% mana icy_veins
3:32.349 frostbolt Fluffy_Pillow 164673.9/168000: 98% mana brain_freeze
3:34.132 frostfire_bolt Fluffy_Pillow 164044.2/168000: 98% mana brain_freeze, fingers_of_frost
3:35.470 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
3:37.252 ice_lance Fluffy_Pillow 167367.0/168000: 100% mana fingers_of_frost(2)
3:38.590 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
3:39.928 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
3:41.711 frostbolt Fluffy_Pillow 167370.3/168000: 100% mana
3:43.495 water_jet Fluffy_Pillow 166743.8/168000: 99% mana
3:43.495 frostbolt Fluffy_Pillow 166743.8/168000: 99% mana
3:45.279 frostbolt Fluffy_Pillow 166117.3/168000: 99% mana enhanced_frostbolt
3:46.619 ice_nova Fluffy_Pillow 164053.9/168000: 98% mana brain_freeze, fingers_of_frost
3:47.957 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost(2)
3:49.295 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost
3:50.633 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
3:51.973 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
3:53.757 frostbolt Fluffy_Pillow 167373.5/168000: 100% mana
3:55.540 frostbolt Fluffy_Pillow 166743.8/168000: 99% mana brain_freeze, fingers_of_frost
3:57.323 frostfire_bolt Fluffy_Pillow 166114.1/168000: 99% mana brain_freeze, fingers_of_frost(2)
3:58.663 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
4:00.002 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
4:01.341 mirror_image Fluffy_Pillow 168000.0/168000: 100% mana
4:02.682 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt
4:04.019 frozen_orb Fluffy_Pillow 165926.9/168000: 99% mana brain_freeze
4:05.359 ice_lance Fluffy_Pillow 154263.5/168000: 92% mana brain_freeze, fingers_of_frost
4:06.697 frostfire_bolt Fluffy_Pillow 156993.6/168000: 93% mana brain_freeze
4:08.035 frostbolt Fluffy_Pillow 161323.8/168000: 96% mana
4:09.817 frostbolt Fluffy_Pillow 160690.8/168000: 96% mana brain_freeze
4:11.601 ice_nova Fluffy_Pillow 160064.3/168000: 95% mana brain_freeze
4:12.938 frostfire_bolt Fluffy_Pillow 164391.2/168000: 98% mana brain_freeze
4:14.278 water_jet Fluffy_Pillow 168000.0/168000: 100% mana
4:14.278 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:16.063 frostbolt Fluffy_Pillow 167376.7/168000: 100% mana
4:17.846 ice_lance Fluffy_Pillow 166747.0/168000: 99% mana fingers_of_frost
4:19.184 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, enhanced_frostbolt
4:20.523 ice_lance Fluffy_Pillow 165933.4/168000: 99% mana fingers_of_frost(2)
4:21.862 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
4:23.199 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:24.983 frostbolt Fluffy_Pillow 167373.5/168000: 100% mana
4:26.766 frostbolt Fluffy_Pillow 166743.8/168000: 99% mana brain_freeze
4:28.548 frostfire_bolt Fluffy_Pillow 166110.8/168000: 99% mana brain_freeze(2), fingers_of_frost
4:29.885 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost
4:31.224 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
4:32.563 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:34.348 frostbolt Fluffy_Pillow 167376.7/168000: 100% mana brain_freeze
4:36.133 frostfire_bolt Fluffy_Pillow 166753.5/168000: 99% mana brain_freeze
4:37.472 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana
4:38.810 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt
4:40.147 frostbolt Fluffy_Pillow 165926.9/168000: 99% mana
4:41.931 water_jet Fluffy_Pillow 165300.4/168000: 98% mana
4:41.931 frostbolt Fluffy_Pillow 165300.4/168000: 98% mana
4:43.714 frostbolt Fluffy_Pillow 164670.7/168000: 98% mana
4:45.499 ice_lance Fluffy_Pillow 164047.4/168000: 98% mana fingers_of_frost
4:46.837 ice_lance Fluffy_Pillow 166777.6/168000: 99% mana fingers_of_frost
4:48.174 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:49.957 frostbolt Fluffy_Pillow 167370.3/168000: 100% mana
4:51.740 frostbolt Fluffy_Pillow 166740.5/168000: 99% mana
4:53.521 frostbolt Fluffy_Pillow 166104.4/168000: 99% mana
4:55.303 frostbolt Fluffy_Pillow 165471.4/168000: 98% mana enhanced_frostbolt
4:56.641 frostbolt Fluffy_Pillow 163401.5/168000: 97% mana

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 674 642 642
Agility 935 891 891
Stamina 4093 3721 3721
Intellect 3685 3248 3146 (2049)
Spirit 1155 1155 1155
Health 245580 223260 0
Mana 168000 168000 0
Spell Power 5105 4204 956
Crit 11.41% 6.41% 155
Haste 12.37% 7.02% 596
Multistrike 31.89% 17.30% 1142
Damage / Heal Versatility 4.76% 1.76% 229
ManaReg per Second 3236 3082 0
Mastery 44.00% 34.00% 990
Armor 612 612 612

Talents

Level
15 Evanesce Blazing Speed Ice Floes
30 Alter Time Flameglow Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Frost Bomb (Frost Mage) Unstable Magic Ice Nova (Frost Mage)
90 Mirror Image Rune of Power Incanter's Flow
100 Thermal Void (Frost Mage) Prismatic Crystal Comet Storm (Frost Mage)

Profile

mage="Zentimeter"
origin="http://eu.battle.net/wow/en/character/forscherliga/Zentimeter/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/110/70512494-avatar.jpg"
level=100
race=gnome
role=spell
position=back
professions=tailoring=670/enchanting=655
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eb!2201200
glyphs=icy_veins/splitting_ice/water_elemental/conjure_familiar/evaporation/momentum
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/arcane_brilliance
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/frostbolt

# Executed every time the actor is available.

actions=counterspell,if=target.debuff.casting.react
actions+=/blink,if=movement.distance>10
actions+=/blazing_speed,if=movement.remains>0
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/mirror_image
actions+=/ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
actions+=/rune_of_power,if=buff.rune_of_power.remains<cast_time
actions+=/rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
actions+=/call_action_list,name=cooldowns,if=time_to_die<24
actions+=/call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
actions+=/call_action_list,name=aoe,if=active_enemies>=4
actions+=/call_action_list,name=single_target

# Actions while Prismatic Crystal is active
actions.crystal_sequence=frost_bomb,if=active_enemies=1&current_target!=prismatic_crystal&remains<10
actions.crystal_sequence+=/frozen_orb
actions.crystal_sequence+=/call_action_list,name=cooldowns
actions.crystal_sequence+=/prismatic_crystal
actions.crystal_sequence+=/frost_bomb,if=talent.prismatic_crystal.enabled&current_target=prismatic_crystal&active_enemies>1&!ticking
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
actions.crystal_sequence+=/ice_nova,if=charges=2
actions.crystal_sequence+=/frostfire_bolt,if=buff.brain_freeze.react
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react
actions.crystal_sequence+=/ice_nova
actions.crystal_sequence+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2),if=active_enemies>=5
actions.crystal_sequence+=/frostbolt

# Consolidated damage cooldown abilities
actions.cooldowns=icy_veins
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up

# AoE sequence
actions.aoe=call_action_list,name=cooldowns
actions.aoe+=/frost_bomb,if=remains<action.ice_lance.travel_time&(cooldown.frozen_orb.remains<gcd.max|buff.fingers_of_frost.react=2)
actions.aoe+=/frozen_orb
actions.aoe+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.up
actions.aoe+=/comet_storm
actions.aoe+=/ice_nova
actions.aoe+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2)

# Single target sequence
actions.single_target=call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
# Safeguards against losing FoF and BF to buff expiry
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
# Frozen Orb usage without Prismatic Crystal
actions.single_target+=/frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
actions.single_target+=/frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
# Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
actions.single_target+=/frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
actions.single_target+=/ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
actions.single_target+=/comet_storm
actions.single_target+=/ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react
actions.single_target+=/ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
actions.single_target+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
# Camp procs and spam Frostbolt while 4T17 buff is up
actions.single_target+=/frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
actions.single_target+=/ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
actions.single_target+=/water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
actions.single_target+=/frostbolt
actions.single_target+=/ice_lance,moving=1

head=vilebreath_mask,id=113596
neck=cratermaker_choker,id=116285,enchant=75mult
shoulders=slaughterhouse_spaulders,id=113609
back=kyusys_tarflame_doomcloak,id=119346,enchant=gift_of_multistrike
chest=hexweave_robe,id=114813,bonus_id=195/525/538
tabard=stormwind_tabard,id=118365
wrists=crystalwoven_bracers,id=113642
hands=sterilized_handwraps,id=115998,bonus_id=563,gems=35mult
waist=hexweave_belt,id=114816,bonus_id=184/525/538
legs=hexweave_leggings,id=114811,bonus_id=133/525/538
feet=felflame_sandals,id=109797,bonus_id=524
finger1=diamondglow_circle,id=109763,bonus_id=524,enchant=30mult
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=50mult
trinket1=crystalline_blood_drop,id=110005,bonus_id=524
trinket2=tovras_lightning_repository,id=110001,bonus_id=524
main_hand=dagger_of_the_sanguine_emeralds,id=110050,bonus_id=524,enchant=mark_of_the_shattered_hand
off_hand=interlopers_mossy_skull,id=119176,bonus_id=43/524

# Gear Summary
# gear_stamina=2831
# gear_intellect=2049
# gear_spell_power=956
# gear_crit_rating=155
# gear_haste_rating=596
# gear_mastery_rating=990
# gear_armor=612
# gear_multistrike_rating=1088
# gear_versatility_rating=229

Zambo

Zambo : 25647 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
25646.6 25646.6 11.2 / 0.044% 3554.1 / 13.9% 75.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
340.7 340.7 Mana 1.59% 47.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/dalvengyr/Zambo/advanced
Talents
  • 15: Pursuit of Justice
  • 30: Fist of Justice
  • 45: Selfless Healer
  • 60: Unbreakable Spirit
  • 75: Divine Purpose
  • 90: Execution Sentence
  • 100: Final Verdict (Retribution Paladin)
  • Talent Calculator
Glyphs
  • Glyph of Divine Storm
  • Glyph of Templar's Verdict
  • Glyph of Mass Exorcism
  • Glyph of Bladed Judgment
  • Glyph of Fire From the Heavens
  • Glyph of Winged Vengeance
Professions
  • mining: 700
  • blacksmithing: 690

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Zambo+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:51919|20302|19688|15532|9083|9007|6534|2467&chds=0,103838&chco=FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,C79C6E&chm=t++51919++execution_sentence,FFE57F,0,0,15|t++20302++final_verdict,FFE57F,1,0,15|t++19688++divine_storm,FFE57F,2,0,15|t++15532++hammer_of_wrath,FFE57F,3,0,15|t++9083++judgment,FFE57F,4,0,15|t++9007++exorcism,FFE57F,5,0,15|t++6534++crusader_strike,C79C6E,6,0,15|t++2467++melee,C79C6E,7,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zambo+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:25,22,10,8,7,7,6,5,5,3,2,1&chds=0,100&chdls=ffffff&chco=FFE57F,FFE57F,C79C6E,FFE57F,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,FFE57F&chl=hand_of_light|final_verdict|melee|hammer_of_wrath|crusader_strike|divine_storm|judgment|seal_of_truth_proc|execution_sentence|censure|shattered_bleed|exorcism&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Zambo+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gimosuw0368666310zxvrrpmlkkigfffffeeedccccbcccaaaaZXXYYYYZZZabbcbbcbbbccdccbcbbbaYZYYZZYZYZYYYZZYYZYYZYYZYYZYYYYXZbbcffgjkmnoprqrsuuwwttsqppmljihgffedbbbaaaZZaZZZZZZZZaaaaaZYZZZaaabbcddddeddedeffffeefeddcccccccccdccdccdcdcdddddddddddcccdddefgghjjjkkklklmnnmmlkkjiigggfffeeedddddddddddddddddddddccbccccdddefffffffffgggggfgfffeddcdcdccddcdccdccdccdcccdccccccabbbbaaaYWWUTRQPNM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.532781,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=25647|max=48137&chxp=1,1,53,100 http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Zambo+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:6,21,32,54,92,132,254,331,440,619,773,901,1171,1273,1479,1578,1666,1670,1660,1540,1467,1364,1241,967,889,751,623,478,398,319,227,171,130,90,58,46,28,20,16,9,4,3,2,3,1,2,0,0,0,1&chds=0,1670&chbh=5&chxt=x&chxl=0:|min=22902|avg=25647|max=30412&chxp=0,1,37,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zambo+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:28.3,26.2,16.5,12.8,8.6,3.9,2.4,1.6&chds=0,100&chdls=ffffff&chco=FFE57F,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,ffffff&chl=final_verdict 85.1s|crusader_strike 78.7s|judgment 49.7s|hammer_of_wrath 38.6s|divine_storm 25.9s|exorcism 11.6s|execution_sentence 7.2s|waiting 4.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Zambo 25647
censure 735 2.9% 295.9 1.01sec 746 0 Periodic 99.4 1826 3664 2076 13.6% 23.5 548 1099 13.6% 99.1%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 295.94 295.94 99.36 99.36 0.0000 3.0000 220903.75 220903.75 0.00 741.11 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 295.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.2 13.64% 1099.02 1019 1512 1051.95 0 1512 3518 3518 0.00
multistrike 20.3 86.36% 547.84 510 756 548.27 510 651 11108 11108 0.00
hit 85.8 86.39% 1826.06 1699 2520 1827.57 1758 1889 156746 156746 0.00
crit 13.5 13.61% 3663.66 3398 5039 3667.61 3398 4661 49531 49531 0.00
 
DPS Timeline Chart
 

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.061776
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
crusader_strike 1710 6.7% 61.8 4.84sec 8319 6534 Direct 61.8 6840 13735 7769 13.5% 14.6 2052 4121 13.5%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.83 61.83 0.00 0.00 1.2732 0.0000 514406.35 790561.34 34.93 6534.14 6534.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.97 13.48% 4121.16 3860 5492 3537.55 0 5492 8113 12469 29.97
multistrike 12.64 86.52% 2051.99 1930 2746 2053.19 1930 2583 25936 39860 34.93
hit 53.50 86.53% 6839.82 6433 9154 6844.40 6467 7125 365951 562409 34.93
crit 8.33 13.47% 13734.63 12867 18307 13743.93 0 18307 114406 175824 34.92
 
DPS Timeline Chart
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:640.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<5
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:{$?s85673=true}|s85256[An instant strike that causes $sw2 Physical damage and grants 1 Holy Power.][An instant strike that causes $sw2 Physical damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
divine_storm 1701 6.6% 20.3 14.10sec 25213 19688 Direct 20.3 20732 41637 23543 13.5% 4.8 6221 12472 13.5%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.26 20.26 0.00 0.00 1.2806 0.0000 510806.79 510806.79 0.00 19688.06 19688.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.65 13.47% 12471.86 11568 16459 5861.15 0 16459 8045 8045 0.00
multistrike 4.14 86.53% 6220.55 5784 8230 6090.26 0 8230 25779 25779 0.00
hit 17.53 86.55% 20731.71 19280 27432 20748.88 19280 24375 363526 363526 0.00
crit 2.72 13.45% 41636.64 38560 54864 38711.52 0 54864 113457 113457 0.00
 
DPS Timeline Chart
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Deals $sw1 Holy damage to all enemies within $A1 yards. {$?s63220=true}[Using Divine Storm will also heal you for {$115515s1=4}% of your maximum health.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.78
 
execution_sentence 1247 4.9% 5.4 60.99sec 68861 51919 Periodic 53.2 5708 11723 6560 14.2% 12.6 1718 3541 14.2% 17.7%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 5.43 53.22 53.22 1.3265 1.0000 373919.52 373919.52 0.00 6188.88 51918.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.8 14.19% 3540.86 1129 19738 2922.29 0 19738 6308 6308 0.00
multistrike 10.8 85.81% 1718.07 564 9869 1718.22 624 7123 18504 18504 0.00
hit 45.7 85.83% 5708.29 1881 32896 5715.82 3167 7221 260734 260734 0.00
crit 7.5 14.17% 11722.94 3762 65792 11756.75 0 65792 88373 88373 0.00
 
DPS Timeline Chart
 

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4096.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc114916=A hammer slowly falls from the sky, causing ${$SPH*$114916m2/1000+26.72716306*$114916m1} Holy damage over {$114916d=10 seconds}. Damage increases over time, culminating in a final burst. Dispelling the effect triggers the final burst.} |CFFFFFFFFStay of Execution|R On a friendly target, the falling hammer heals for ${$SPH*$114917m2/1000+26.72716306*$114917m1} over {$114917d=10 seconds}. This healing is a large burst at first, and then decreases over time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.342049
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
exorcism 346 1.4% 9.1 18.19sec 11426 9007 Direct 9.1 9405 18815 10672 13.5% 2.2 2822 5642 13.2%  

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.13 9.13 0.00 0.00 1.2685 0.0000 104351.58 104351.58 0.00 9007.47 9007.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.28 13.21% 5641.57 5565 6878 1394.27 0 6878 1606 1606 0.00
multistrike 1.87 86.79% 2821.58 2782 3439 2373.06 0 3439 5278 5278 0.00
hit 7.90 86.54% 9405.31 9275 11464 9407.17 0 11464 74335 74335 0.00
crit 1.23 13.46% 18814.66 18550 22928 13465.01 0 22928 23134 23134 0.00
 
DPS Timeline Chart
 

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1280.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:
  • description:Blasts the target with Holy Light, causing {$s1=1} Holy damage and generating 1 Holy Power. Your autoattacks have a {$87138h=20}% chance of resetting the cooldown of your Exorcism.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.686240
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
final_verdict 5750 22.4% 66.6 4.48sec 25944 20302 Direct 66.6 21323 42841 24235 13.5% 15.7 6396 12845 13.4%  

Stats details: final_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.59 66.59 0.00 0.00 1.2779 0.0000 1727620.91 1727620.91 0.00 20302.50 20302.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.11 13.44% 12844.71 11865 16881 11277.74 0 16881 27059 27059 0.00
multistrike 13.56 86.56% 6396.27 5932 8441 6401.41 5932 8441 86752 86752 0.00
hit 57.58 86.47% 21322.92 19775 28135 21339.79 20419 22582 1227740 1227740 0.00
crit 9.01 13.53% 42840.55 39549 56271 42877.52 0 56271 386070 386070 0.00
 
DPS Timeline Chart
 

Action details: final_verdict

Static Values
  • id:157048
  • school:holy
  • resource:holy_power
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5|buff.holy_avenger.up&holy_power>=3
Spelldata
  • id:157048
  • name:Final Verdict
  • school:holy
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
hammer_of_wrath 2005 7.8% 30.2 10.16sec 19820 15532 Direct 30.2 16240 32835 18515 13.7% 7.1 4873 9844 13.7%  

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.24 30.23 0.00 0.00 1.2761 0.0000 599302.66 599302.66 0.00 15532.41 15532.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.98 13.73% 9843.57 8366 12408 6173.80 0 12408 9648 9648 0.00
multistrike 6.16 86.27% 4872.80 4183 6204 4865.31 0 6204 30009 30009 0.00
hit 26.08 86.29% 16239.53 13943 20681 16251.58 14850 17533 423560 423560 0.00
crit 4.14 13.71% 32834.88 27886 41361 32458.12 0 41361 136085 136085 0.00
 
DPS Timeline Chart
 

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a magical hammer that strikes an enemy for {$s1=1} Holy damage{$?s53503=false}[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health{$?s53503=false}[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.028000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
hand_of_light 6419 25.0% 221.1 1.68sec 8715 0 Direct 221.1 8715 0 8715 0.0% 0.0 0 0 0.0%  

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 221.11 221.11 0.00 0.00 0.0000 0.0000 1927051.68 1927051.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 221.11 100.00% 8715.13 1110 32349 8726.18 7508 10137 1927052 1927052 0.00
 
DPS Timeline Chart
 

Action details: hand_of_light

Static Values
  • id:96172
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3860.10
  • base_dd_max:3860.10
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
judgment 1501 5.9% 39.1 7.63sec 11538 9083 Direct 39.1 9471 19092 10774 13.5% 9.2 2842 5723 13.6%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.11 39.11 0.00 0.00 1.2703 0.0000 451263.26 451263.26 0.00 9082.67 9082.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.26 13.63% 5722.64 5248 7783 4078.74 0 7783 7200 7200 0.00
multistrike 7.97 86.37% 2841.92 2624 3892 2842.87 0 3892 22657 22657 0.00
hit 33.81 86.45% 9471.15 8746 12972 9478.66 8811 10400 320251 320251 0.00
crit 5.30 13.55% 19091.91 17492 25944 19033.08 0 25944 101155 101155 0.00
 
DPS Timeline Chart
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.empowered_seals.enabled&time<2
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Causes {$s1=1} Holy damage {$?s105424=false}[and generates 1 Holy Power]?s85256[and generates 1 Holy Power][]. Requires an active Seal to cast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.696000
  • spell_power_mod.direct:0.576000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 2462 9.6% 98.2 3.05sec 7535 2467 Direct 98.2 6182 12443 7038 13.7% 23.1 1855 3728 13.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.17 98.17 0.00 0.00 3.0545 0.0000 739662.30 1136744.17 34.93 2466.74 2466.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.15 13.60% 3728.15 3447 4918 3567.87 0 4918 11730 18027 33.41
multistrike 19.98 86.40% 1854.88 1723 2459 1856.36 1723 2181 37063 56960 34.93
hit 84.75 86.33% 6181.69 5745 8197 6186.32 5990 6386 523872 805109 34.93
crit 13.42 13.67% 12442.66 11489 16394 12453.86 11489 15525 166997 256648 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
seal_of_truth_proc 1378 5.4% 295.9 1.01sec 1399 0 Direct 295.9 1146 2305 1306 13.9% 69.9 344 692 13.9%  

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 295.94 295.94 0.00 0.00 0.0000 0.0000 413947.00 413947.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.70 13.89% 691.66 636 907 692.26 0 907 6712 6712 0.00
multistrike 60.16 86.11% 343.72 318 453 344.00 321 378 20678 20678 0.00
hit 254.91 86.14% 1145.51 1059 1512 1146.40 1115 1174 292006 292006 0.00
crit 41.02 13.86% 2304.74 2119 3023 2306.57 2119 2586 94551 94551 0.00
 
DPS Timeline Chart
 

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.12
 
shattered_bleed 393 1.5% 17.4 17.68sec 6786 0 Direct 17.4 1665 3334 1898 14.0% 4.1 500 1000 13.9%  
Periodic 97.3 794 0 794 0.0% 22.9 241 0 0.0% 32.3%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.41 17.41 97.30 97.30 0.0000 1.0000 118122.45 118122.45 0.00 1213.95 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.57 13.92% 999.97 964 1157 434.20 0 1157 572 572 0.00
multistrike 3.54 86.08% 499.51 482 578 484.02 0 578 1766 1766 0.00
hit 14.98 86.05% 1664.83 1606 1928 1664.61 1606 1836 24938 24938 0.00
crit 2.43 13.95% 3333.83 3213 3855 3048.33 0 3855 8096 8096 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 22.9 100.00% 240.94 241 241 240.94 241 241 5529 5529 0.00
hit 97.3 100.00% 793.60 1 803 793.89 765 803 77221 77221 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Zambo
avenging_wrath 2.9 121.96sec

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 2.94 2.94 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.44 82.96% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.50 17.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
HPS Timeline Chart
 

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:119.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:talent.seraphim.enabled
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
 
draenic_strength_potion 2.0 0.00sec

Stats details: draenic_strength_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156428
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156428
  • name:Draenic Strength Potion
  • school:physical
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
 
glyph_of_divine_storm 20.3 14.10sec

Stats details: glyph_of_divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 20.25 20.25 0.00 0.00 0.0000 0.0000 0.00 273279.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.81 17.01% 0.00 0 0 0.00 0 0 0 5245 54.77
multistrike 3.95 82.99% 0.00 0 0 0.00 0 0 0 12795 97.32
hit 16.85 83.19% 0.00 0 0 0.00 0 0 0 181763 100.00
crit 3.41 16.81% 0.00 0 0 0.00 0 0 0 73477 96.25
 
HPS Timeline Chart
 

Action details: glyph_of_divine_storm

Static Values
  • id:63220
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:
Spelldata
  • id:63220
  • name:Glyph of Divine Storm
  • school:physical
  • tooltip:
  • description:Your Divine Storm also heals you for {$115515s1=4}% of your maximum health.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
avenging_wrath 2.9 0.0 122.0sec 122.0sec 18.99% 41.07% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • avenging_wrath_1:18.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_crusader 20.4 1.3 13.9sec 13.1sec 17.79% 100.00% 1.3(1.3)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_divine_crusader
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_crusader_1:17.79%

Trigger Attempt Success

  • trigger_pct:24.80%

Spelldata details

  • id:144595
  • name:Divine Crusader
  • tooltip:Your next Divine Storm is free and deals {$s2=50}% more damage.
  • description:{$@spelldesc144593=Holy Power consumers have a 25% chance to make your next Divine Storm free and deal {$144595s2=50}% more damage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
divine_purpose 20.5 1.2 13.9sec 13.0sec 15.45% 100.00% 1.2(1.2)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_purpose_1:15.45%

Trigger Attempt Success

  • trigger_pct:24.80%

Spelldata details

  • id:86172
  • name:Divine Purpose
  • tooltip:
  • description:{$?s114163=false}[Eternal Flame][Word of Glory]{$?s53600=false}[ and Shield of the Righteous have]?s53563[ and Light of Dawn have]?s85256[, Templar's Verdict, and Divine Storm have][ has] a {$s1=25}% chance to cause your next {$?s114163=false}[Eternal Flame][Word of Glory] or {$?s53600=false}[Shield of the Righteous]?s53563[Light of Dawn]?s157048[Final Verdict or Divine Storm][Templar's Verdict or Divine Storm] to consume no Holy Power but cast as if 3 were consumed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
draenic_strength_potion 2.0 0.0 123.2sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
final_verdict 21.0 61.2 14.1sec 3.6sec 76.93% 76.93% 61.2(61.2)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • final_verdict_1:76.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157048
  • name:Final Verdict
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
selfless_healer 3.4 45.0 97.0sec 6.2sec 94.40% 94.40% 39.0(39.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_selfless_healer
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • selfless_healer_1:6.20%
  • selfless_healer_2:6.01%
  • selfless_healer_3:82.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114250
  • name:Selfless Healer
  • tooltip:Your next Flash of Light casts $w1% faster, costs $w3% less mana, and heals for $w2% greater effectiveness on others.
  • description:{$@spelldesc85804=Your successful Judgments reduce the cast time and mana cost of your next Flash of Light by {$114250s1=35}%, and increase its effect on others by $?c1[{$114250s4=35}][{$114250s2=20}]%. Stacks up to 3 times.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
tectus_heartbeat 5.7 0.0 50.9sec 50.3sec 18.66% 18.67% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_tectus_heartbeat
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1743.00

Stack Uptimes

  • tectus_heartbeat_1:18.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177040
  • name:Tectus' Heartbeat
  • tooltip:Increases Critical Strike by {$s1=1135}.
  • description:Increases Critical Strike by {$s1=1135} for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
seal_of_truth

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_seal_of_truth
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • seal_of_truth_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31801
  • name:Seal of Truth
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zambo
crusader_strike Mana 61.8 39573.1 640.0 640.0 13.0
execution_sentence Mana 5.4 22241.3 4096.0 4095.9 16.8
exorcism Mana 9.1 11690.1 1280.0 1280.0 8.9
final_verdict Holy Power 66.6 138.7 2.1 2.1 12453.5
hammer_of_wrath Mana 30.2 29027.5 960.0 960.0 20.6
Resource Gains Type Count Total Average Overflow
glyph_of_divine_storm Health 25.02 0.00 (0.00%) 0.00 273279.27 100.00%
external_healing Health 8.68 0.00 (0.00%) 0.00 80230.16 100.00%
leech Health 1319.33 0.00 (0.00%) 0.00 33605.90 100.00%
sword_of_light Mana 149.64 101725.79 (100.00%) 679.79 185590.50 64.59%
crusader_strike Holy Power 61.83 61.83 (44.07%) 1.00 0.00 0.00%
exorcism Holy Power 9.13 9.13 (6.51%) 1.00 0.00 0.00%
hammer_of_wrath Holy Power 30.23 30.23 (21.54%) 1.00 0.00 0.00%
judgment Holy Power 39.11 39.11 (27.88%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 338.07 340.75
Holy Power 0.47 0.46
Combat End Resource Mean Min Max
Mana 31180.60 26944.00 32000.00
Holy Power 1.58 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 39.6%

Procs

Count Interval
divine_purpose 21.7 13.0sec
divine_crusader 21.7 13.1sec
exorcism_cd_reset 19.7 14.7sec
wasted_exorcism_cd_reset 14.2 20.5sec

Statistics & Data Analysis

Fight Length
Sample Data Zambo Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Zambo Damage Per Second
Count 25000
Mean 25646.63
Minimum 22902.38
Maximum 30412.19
Spread ( max - min ) 7509.81
Range [ ( max - min ) / 2 * 100% ] 14.64%
Standard Deviation 907.1374
5th Percentile 24215.37
95th Percentile 27206.18
( 95th Percentile - 5th Percentile ) 2990.81
Mean Distribution
Standard Deviation 5.7372
95.00% Confidence Intervall ( 25635.39 - 25657.88 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4805
0.1 Scale Factor Error with Delta=300 7024
0.05 Scale Factor Error with Delta=300 28098
0.01 Scale Factor Error with Delta=300 702473
Distribution Chart
DPS(e)
Sample Data Zambo Damage Per Second (Effective)
Count 25000
Mean 25646.63
Minimum 22902.38
Maximum 30412.19
Spread ( max - min ) 7509.81
Range [ ( max - min ) / 2 * 100% ] 14.64%
Damage
Sample Data Zambo Damage
Count 25000
Mean 7701358.25
Minimum 5646417.76
Maximum 9972269.81
Spread ( max - min ) 4325852.05
Range [ ( max - min ) / 2 * 100% ] 28.08%
DTPS
Sample Data Zambo Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zambo Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Zambo Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zambo Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zambo Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zambo Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ZamboTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Zambo Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=sleeper_surprise
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up
4 0.00 seal_of_truth,if=active_enemies<2
5 0.00 seal_of_righteousness,if=active_enemies>=2
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_strength
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 rebuke
9 1.00 potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
A 1.00 auto_attack
B 0.00 speed_of_light,if=movement.distance>5
C 0.00 judgment,if=talent.empowered_seals.enabled&time<2
D 5.43 execution_sentence
E 0.00 lights_hammer
F 0.00 holy_avenger,sync=seraphim,if=talent.seraphim.enabled
G 0.00 holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
H 0.00 avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
I 2.94 avenging_wrath,if=!talent.seraphim.enabled
J 0.00 blood_fury
K 0.00 berserking
L 0.00 arcane_torrent
M 0.00 seraphim
N 0.00 wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
O 0.00 call_action_list,name=aoe,if=active_enemies>=5
P 0.00 call_action_list,name=cleave,if=active_enemies>=3
Q 0.00 call_action_list,name=single
actions.single
# count action,conditions
R 0.10 divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
S 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
T 0.00 divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
U 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
V 0.00 templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
W 0.00 templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
X 0.00 divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
Y 2.32 final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
Z 0.25 final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
a 30.24 hammer_of_wrath
b 0.00 judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
c 0.00 judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
d 0.00 exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
e 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
f 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
g 10.53 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
h 34.32 final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
i 0.00 templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
j 61.83 crusader_strike,if=holy_power<5
k 0.00 divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
l 9.63 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
m 9.54 final_verdict,if=buff.divine_purpose.react
n 10.67 final_verdict,if=holy_power>=4
o 0.00 judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
p 0.00 exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
q 39.11 judgment,,if=holy_power<5
r 9.50 final_verdict,if=holy_power>=3
s 0.00 exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
t 0.00 templars_verdict,if=buff.divine_purpose.react
u 0.00 divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
v 0.00 templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
w 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
x 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
y 9.13 exorcism,if=holy_power<5
z 0.00 templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
{ 0.00 holy_prism

Sample Sequence

0147ADIajqhajqhaghhajhgahghjqrjyqjnyjqnjyqjYljqnjyqjYyjnqjryjDqjnljqrjmqjryjqrjqjrmjqyjnljqrjlqjryjqrjlmjmDI9aghgajqhahhjahjqyjnqjrljqyjnljqrjmljqrjyqjnmDjlqahgjahjqahjqahjqahjqahgjaqhgajqhajqhajqhajDIqahghagjhajqhagjqahjqahjqahhgajhgahgjahh

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre seal_of_truth Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power draenic_strength_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:00.000 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:01.325 avenging_wrath Zambo 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, tectus_heartbeat, draenic_strength_potion
0:01.325 hammer_of_wrath Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:02.347 crusader_strike Fluffy_Pillow 28864.0/32000: 90% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:03.367 judgment Fluffy_Pillow 28224.0/32000: 88% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:04.389 final_verdict Fluffy_Pillow 30144.0/32000: 94% mana | 3.0/5: 60% holy_power bloodlust, selfless_healer(2), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:05.411 hammer_of_wrath Fluffy_Pillow 30144.0/32000: 94% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, selfless_healer(2), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:06.432 crusader_strike Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(2), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:07.452 judgment Fluffy_Pillow 30464.0/32000: 95% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(2), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:08.472 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:09.493 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, tectus_heartbeat, draenic_strength_potion
0:10.514 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
0:11.536 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, divine_purpose, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:12.557 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:13.579 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:14.600 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:15.623 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:16.647 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
0:17.669 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, divine_purpose, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
0:18.690 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, divine_purpose, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
0:19.710 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
0:20.732 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, divine_purpose, selfless_healer(3), avenging_wrath
0:21.755 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(3)
0:22.777 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict
0:23.799 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer
0:24.821 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, selfless_healer
0:25.842 exorcism Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer
0:26.862 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer
0:27.884 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(2)
0:28.905 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, final_verdict, selfless_healer(2)
0:29.926 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(2)
0:30.948 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(2)
0:31.971 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(2)
0:32.992 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, final_verdict, selfless_healer(3)
0:34.013 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(3)
0:35.034 exorcism Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(3)
0:36.056 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(3)
0:37.078 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, final_verdict, selfless_healer(3)
0:38.101 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power bloodlust, final_verdict, selfless_healer(3)
0:39.121 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(3), divine_crusader
0:40.141 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, selfless_healer(3)
0:41.162 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power selfless_healer(3)
0:42.487 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power selfless_healer(3)
0:43.812 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
0:45.138 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
0:46.466 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
0:47.793 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
0:49.119 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power final_verdict, selfless_healer(3)
0:50.444 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
0:51.770 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
0:53.097 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
0:54.425 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
0:55.752 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
0:57.077 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
0:58.404 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
0:59.730 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
1:01.055 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
1:02.381 judgment Fluffy_Pillow 29824.0/32000: 93% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
1:03.706 crusader_strike Fluffy_Pillow 29824.0/32000: 93% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
1:05.033 final_verdict Fluffy_Pillow 31104.0/32000: 97% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
1:06.358 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
1:07.685 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
1:09.012 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
1:10.337 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
1:11.664 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3)
1:12.991 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3), tectus_heartbeat
1:14.318 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:15.646 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:16.971 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:18.297 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:19.623 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:20.948 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:22.275 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
1:23.601 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
1:24.927 Waiting 1.400 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
1:26.327 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
1:27.653 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
1:28.979 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:30.305 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3), tectus_heartbeat
1:31.633 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:32.959 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:34.286 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:35.613 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:36.940 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:38.267 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
1:39.594 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
1:40.920 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
1:42.248 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
1:43.574 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader
1:44.899 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
1:46.226 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
1:47.553 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
1:48.880 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
1:50.208 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
1:51.534 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
1:52.859 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
1:54.185 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
1:55.513 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3), divine_crusader
1:56.837 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3), divine_crusader
1:58.162 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, selfless_healer(3)
1:59.488 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3)
2:00.816 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_purpose, final_verdict, selfless_healer(3)
2:02.142 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), divine_crusader
2:03.469 avenging_wrath Zambo 27904.0/32000: 87% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), divine_crusader
2:03.469 potion Fluffy_Pillow 27904.0/32000: 87% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader
2:03.469 hammer_of_wrath Fluffy_Pillow 27904.0/32000: 87% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
2:04.796 divine_storm Fluffy_Pillow 28864.0/32000: 90% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
2:06.123 final_verdict Fluffy_Pillow 30784.0/32000: 96% mana | 3.0/5: 60% holy_power selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
2:07.451 divine_storm Fluffy_Pillow 30784.0/32000: 96% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
2:08.777 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, draenic_strength_potion
2:10.103 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, draenic_strength_potion
2:11.430 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power avenging_wrath, draenic_strength_potion
2:12.756 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer, avenging_wrath, draenic_strength_potion
2:14.082 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer, avenging_wrath, draenic_strength_potion
2:15.407 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer, avenging_wrath, draenic_strength_potion
2:16.734 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer, avenging_wrath, draenic_strength_potion
2:18.061 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer, avenging_wrath, draenic_strength_potion
2:19.389 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer, avenging_wrath, draenic_strength_potion
2:20.717 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer, avenging_wrath, draenic_strength_potion
2:22.043 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer, avenging_wrath, draenic_strength_potion
2:23.371 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer, avenging_wrath, draenic_strength_potion
2:24.696 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(2), draenic_strength_potion
2:26.022 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(2), draenic_strength_potion
2:27.348 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(2), draenic_strength_potion
2:28.674 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(2)
2:29.999 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
2:31.326 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
2:32.654 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader
2:33.981 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power selfless_healer(3), divine_crusader
2:35.308 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3), divine_crusader
2:36.634 Waiting 1.300 sec 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3), divine_crusader
2:37.934 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3), divine_crusader
2:39.261 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3), divine_crusader
2:40.586 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power selfless_healer(3), divine_crusader
2:41.913 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
2:43.240 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
2:44.567 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
2:45.894 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
2:47.220 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3)
2:48.547 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3)
2:49.873 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
2:51.200 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
2:52.526 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
2:53.854 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
2:55.180 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
2:56.507 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
2:57.834 judgment Fluffy_Pillow 30720.0/32000: 96% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
2:59.160 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:00.486 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
3:01.812 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3)
3:03.139 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
3:04.467 crusader_strike Fluffy_Pillow 29824.0/32000: 93% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
3:05.795 divine_storm Fluffy_Pillow 29184.0/32000: 91% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), divine_crusader
3:07.121 judgment Fluffy_Pillow 31104.0/32000: 97% mana | 2.0/5: 40% holy_power selfless_healer(3), divine_crusader
3:08.446 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3), divine_crusader
3:09.774 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power selfless_healer(3), divine_crusader
3:11.100 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
3:12.428 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
3:13.754 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power selfless_healer(3)
3:15.079 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
3:16.405 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:17.731 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:19.058 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:20.382 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:21.709 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:23.035 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:24.360 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:25.686 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:27.014 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:28.340 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:29.666 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:30.991 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:32.317 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:33.643 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:34.970 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:36.297 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:37.624 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader, tectus_heartbeat
3:38.952 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power selfless_healer(3), divine_crusader, tectus_heartbeat
3:40.277 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3), divine_crusader, tectus_heartbeat
3:41.604 judgment Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power selfless_healer(3), divine_crusader, tectus_heartbeat
3:42.931 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3), divine_crusader
3:44.258 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader
3:45.584 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power selfless_healer(3)
3:46.911 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
3:48.238 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
3:49.565 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
3:50.892 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:52.217 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:53.543 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:54.870 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:56.196 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:57.524 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:58.852 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:00.177 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:01.503 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
4:02.830 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
4:04.159 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:05.485 avenging_wrath Zambo 27904.0/32000: 87% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:05.485 judgment Fluffy_Pillow 27904.0/32000: 87% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:06.812 hammer_of_wrath Fluffy_Pillow 29824.0/32000: 93% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:08.139 final_verdict Fluffy_Pillow 30784.0/32000: 96% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:09.466 divine_storm Fluffy_Pillow 30784.0/32000: 96% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader
4:10.793 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, selfless_healer(3), avenging_wrath
4:12.119 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader
4:13.445 divine_storm Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader
4:14.772 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3), avenging_wrath
4:16.099 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3), avenging_wrath
4:17.426 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:18.754 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:20.080 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:21.406 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:22.731 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader
4:24.061 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader
4:25.389 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3), avenging_wrath
4:26.717 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
4:28.043 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
4:29.369 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power selfless_healer(3)
4:30.693 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
4:32.020 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:33.346 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:34.673 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
4:36.000 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
4:37.326 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:38.652 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:39.980 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
4:41.307 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3)
4:42.633 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
4:43.960 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3), divine_crusader
4:45.286 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3), divine_crusader
4:46.614 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3), divine_crusader
4:47.939 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3), divine_crusader
4:49.264 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, selfless_healer(3)
4:50.592 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, selfless_healer(3)
4:51.919 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
4:53.244 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power
4:54.570 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power
4:55.895 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power
4:57.221 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4669 4183 4057 (1409)
Agility 477 455 455
Stamina 4495 4087 4087
Intellect 1094 1042 1042
Spirit 782 782 782
Health 269700 245220 0
Mana 32000 32000 0
Holy Power 5 5 0
Spell Power 5136 4183 0
Crit 13.68% 8.68% 405
Haste 13.41% 8.01% 801
Multistrike 11.80% 6.80% 449
Damage / Heal Versatility 7.08% 4.08% 531
Attack Power 5136 4183 0
Mastery 57.49% 43.54% 1248
Armor 2003 2003 2003

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Blinding Light
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence
100 Empowered Seals Seraphim Final Verdict (Retribution Paladin)

Profile

paladin="Zambo"
origin="http://eu.battle.net/wow/en/character/dalvengyr/Zambo/advanced"
thumbnail="http://eu.battle.net/static-render/eu/nazjatar/126/78079358-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=blacksmithing=690/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!2001222
glyphs=divine_storm/templars_verdict/mass_exorcism/bladed_judgment/fire_from_the_heavens/winged_vengeance
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up
actions.precombat+=/seal_of_truth,if=active_enemies<2
actions.precombat+=/seal_of_righteousness,if=active_enemies>=2
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_strength

# Executed every time the actor is available.

actions=rebuke
actions+=/potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
actions+=/auto_attack
actions+=/speed_of_light,if=movement.distance>5
actions+=/judgment,if=talent.empowered_seals.enabled&time<2
actions+=/execution_sentence
actions+=/lights_hammer
actions+=/holy_avenger,sync=seraphim,if=talent.seraphim.enabled
actions+=/holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
actions+=/avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
actions+=/avenging_wrath,if=!talent.seraphim.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/seraphim
actions+=/wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
actions+=/call_action_list,name=aoe,if=active_enemies>=5
actions+=/call_action_list,name=cleave,if=active_enemies>=3
actions+=/call_action_list,name=single

actions.single=divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
actions.single+=/templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
actions.single+=/templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
actions.single+=/final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
actions.single+=/final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
actions.single+=/hammer_of_wrath
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
actions.single+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
actions.single+=/final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
actions.single+=/templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.single+=/crusader_strike,if=holy_power<5
actions.single+=/divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
actions.single+=/final_verdict,if=buff.divine_purpose.react
actions.single+=/final_verdict,if=holy_power>=4
actions.single+=/judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
actions.single+=/exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
actions.single+=/judgment,,if=holy_power<5
actions.single+=/final_verdict,if=holy_power>=3
actions.single+=/exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
actions.single+=/templars_verdict,if=buff.divine_purpose.react
actions.single+=/divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
actions.single+=/templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
actions.single+=/exorcism,if=holy_power<5
actions.single+=/templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
actions.single+=/holy_prism

actions.cleave=final_verdict,if=buff.final_verdict.down&holy_power=5
actions.cleave+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)&!talent.final_verdict.enabled
actions.cleave+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.cleave+=/hammer_of_wrath
actions.cleave+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.cleave+=/divine_storm,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)&!talent.final_verdict.enabled
actions.cleave+=/crusader_strike
actions.cleave+=/divine_storm,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)&!talent.final_verdict.enabled
actions.cleave+=/final_verdict,if=buff.final_verdict.down
actions.cleave+=/divine_storm,if=buff.final_verdict.up
actions.cleave+=/exorcism,if=glyph.mass_exorcism.enabled
actions.cleave+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.cleave+=/judgment
actions.cleave+=/exorcism

actions.aoe=divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)
actions.aoe+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.aoe+=/hammer_of_wrath
actions.aoe+=/hammer_of_the_righteous
actions.aoe+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.aoe+=/divine_storm,if=(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.aoe+=/exorcism,if=glyph.mass_exorcism.enabled
actions.aoe+=/holy_prism,target=self
actions.aoe+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.aoe+=/judgment
actions.aoe+=/exorcism

head=casque_of_the_iron_bomber,id=113600,bonus_id=566
neck=koraghs_family_locket,id=113841,bonus_id=560,enchant=75mastery
shoulders=primal_gladiators_plate_shoulders,id=115740
back=primal_gladiators_cloak_of_cruelty,id=115732,enchant=gift_of_mastery
chest=truesteel_breastplate,id=114232,bonus_id=181/526/534
wrists=crazed_bombers_bracers,id=114496,bonus_id=488
hands=gauntlets_of_the_heavy_hand,id=113632
waist=bouldercrush_girdle,id=118948,bonus_id=141/560
legs=legplates_of_fractured_crystal,id=113648,bonus_id=41
feet=mosscrusher_sabatons,id=113660,bonus_id=560/563,gems=35mastery
finger1=timeless_solium_band_of_brutality,id=118295,enchant=30mastery
finger2=grunts_solid_signet,id=113599,enchant=50mastery
trinket1=grandiose_carnage,id=114552
trinket2=tectus_beating_heart,id=113645
main_hand=grandiose_greataxe,id=115328,bonus_id=115/560,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_strength=2530
# gear_stamina=3197
# gear_crit_rating=405
# gear_haste_rating=801
# gear_mastery_rating=1189
# gear_armor=2003
# gear_multistrike_rating=449
# gear_versatility_rating=431
# gear_leech_rating=120

Ðepeche

Ðepeche : 23904 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
23903.6 23903.6 9.6 / 0.040% 2970.0 / 12.4% 57.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
418.0 418.0 Mana 2.48% 47.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ðepeche/advanced
Talents
  • 15: Pursuit of Justice
  • 30: Fist of Justice
  • 45: Selfless Healer
  • 60: Unbreakable Spirit
  • 75: Sanctified Wrath
  • 90: Execution Sentence
  • 100: Final Verdict (Retribution Paladin)
  • Talent Calculator
Glyphs
  • Glyph of Hand of Sacrifice
  • Glyph of Double Jeopardy
  • Glyph of Templar's Verdict
  • Glyph of Seal of Blood
  • Glyph of Winged Vengeance
  • Glyph of Righteous Retreat
Professions
  • blacksmithing: 700
  • jewelcrafting: 700

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=%C3%90epeche+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:49829|19625|18947|16549|8013|7517|6208|2374&chds=0,99659&chco=FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,C79C6E&chm=t++49829++execution_sentence,FFE57F,0,0,15|t++19625++final_verdict,FFE57F,1,0,15|t++18947++divine_storm,FFE57F,2,0,15|t++16549++hammer_of_wrath,FFE57F,3,0,15|t++8013++exorcism,FFE57F,4,0,15|t++7517++judgment,FFE57F,5,0,15|t++6208++crusader_strike,C79C6E,6,0,15|t++2374++melee,C79C6E,7,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=%C3%90epeche+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,18,15,10,7,6,5,5,5,3,2,1&chds=0,100&chdls=ffffff&chco=FFE57F,FFE57F,FFE57F,C79C6E,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,FFE57F&chl=hand_of_light|final_verdict|hammer_of_wrath|melee|crusader_strike|seal_of_truth_proc|divine_storm|execution_sentence|judgment|censure|shattered_bleed|exorcism&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=%C3%90epeche+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:filoruwz257787545320ywutrqpnmkjiffedbaZYXWWWWVVVUTTSTTTTUUUUWVWVWWWVVXXWXXWWVVVVTUTTTTTTTTTTTTUTTTTTTTTTTTUTTTTSUVXYabcfhjlmmoprstuwwvuvuttsponlmkiihffddbbZYYWWWVVVUVVUUVUTUUUUVVVWWXYXXYYYYYYZZZZZYYZYXXWWXWWXWWXXWXXXXXXXXXXYXXYXXYXWXXXZZabcdegghhiijjklmmmllmlkkjhhhhggeeedcdcbbaaaZYZYXXYXXYXXXWXXXXYYYZZaaaZaaZZaaabaaaZZZYXYXXXXXXYXXXXXYXXYXXXXXYXXXYXXWWWXXYYYZZZaZXXWUTSRQP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.483414,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=23904|max=49447&chxp=1,1,48,100 http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=%C3%90epeche+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,1,8,14,21,31,69,98,150,202,315,428,530,664,757,872,995,1156,1188,1263,1299,1395,1371,1365,1445,1296,1196,1201,1055,881,778,681,519,449,312,267,228,162,120,63,56,36,22,16,8,3,6,5,1&chds=0,1445&chbh=5&chxt=x&chxl=0:|min=21207|avg=23904|max=26868&chxp=0,1,48,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=%C3%90epeche+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:25.8,22.0,21.7,14.8,6.7,4.4,2.4,2.5&chds=0,100&chdls=ffffff&chco=C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,ffffff&chl=crusader_strike 77.7s|final_verdict 66.3s|hammer_of_wrath 65.2s|judgment 44.5s|divine_storm 20.2s|exorcism 13.1s|execution_sentence 7.2s|waiting 7.5s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ðepeche 23904
censure 699 2.9% 300.3 1.00sec 700 0 Periodic 99.4 1690 3517 1983 16.0% 22.1 507 1054 16.0% 99.1%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 300.26 300.26 99.36 99.36 0.0000 3.0000 210161.93 210161.93 0.00 705.03 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 300.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.5 16.02% 1054.05 933 1399 1022.09 0 1399 3735 3735 0.00
multistrike 18.6 83.98% 506.73 466 700 507.10 466 606 9411 9411 0.00
hit 83.4 83.97% 1689.75 1555 2332 1691.02 1629 1754 140983 140983 0.00
crit 15.9 16.03% 3517.45 3109 4664 3522.00 3109 4431 56033 56033 0.00
 
DPS Timeline Chart
 

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.061776
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
crusader_strike 1603 6.7% 61.4 4.89sec 7853 6208 Direct 61.4 6314 13055 7362 15.5% 13.6 1894 3915 15.5%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.40 61.40 0.00 0.00 1.2648 0.0000 482124.92 740949.88 34.93 6208.47 6208.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.12 15.52% 3915.15 3534 5074 3444.64 0 5074 8295 12748 30.69
multistrike 11.53 84.48% 1893.97 1767 2537 1895.39 0 2537 21834 33556 34.93
hit 51.86 84.46% 6314.35 5889 8457 6318.19 6022 6651 327435 503216 34.93
crit 9.54 15.54% 13055.12 11779 16915 13074.00 11779 16915 124561 191430 34.93
 
DPS Timeline Chart
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:640.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<5
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:{$?s85673=true}|s85256[An instant strike that causes $sw2 Physical damage and grants 1 Holy Power.][An instant strike that causes $sw2 Physical damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
divine_storm 1273 5.3% 15.9 17.71sec 23992 18947 Direct 15.9 19173 39826 22491 16.1% 3.5 5756 11969 16.0%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.93 15.93 0.00 0.00 1.2664 0.0000 382286.44 382286.44 0.00 18946.64 18946.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.57 15.96% 11969.21 10590 15207 5131.97 0 15207 6770 6770 0.00
multistrike 2.98 84.04% 5755.57 5295 7604 5408.40 0 7604 17148 17148 0.00
hit 13.37 83.93% 19173.19 17649 25346 19186.84 17649 23957 256418 256418 0.00
crit 2.56 16.07% 39825.90 35299 50692 36810.26 0 50692 101950 101950 0.00
 
DPS Timeline Chart
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Deals $sw1 Holy damage to all enemies within $A1 yards. {$?s63220=false}[Using Divine Storm will also heal you for {$115515s1=4}% of your maximum health.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.78
 
execution_sentence 1199 5.0% 5.5 60.48sec 65500 49829 Periodic 53.7 5168 11401 6275 17.8% 11.9 1548 3419 17.7% 17.8%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.49 5.49 53.70 53.70 1.3145 1.0000 359319.22 359319.22 0.00 5899.57 49829.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.1 17.74% 3419.37 1033 18268 3002.52 0 18268 7220 7220 0.00
multistrike 9.8 82.26% 1548.21 516 9134 1548.59 0 9134 15162 15162 0.00
hit 44.2 82.23% 5167.56 1721 30447 5173.47 3092 6669 228171 228171 0.00
crit 9.5 17.77% 11400.60 3443 60894 11440.56 0 43770 108766 108766 0.00
 
DPS Timeline Chart
 

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4096.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc114916=A hammer slowly falls from the sky, causing ${$SPH*$114916m2/1000+26.72716306*$114916m1} Holy damage over {$114916d=10 seconds}. Damage increases over time, culminating in a final burst. Dispelling the effect triggers the final burst.} |CFFFFFFFFStay of Execution|R On a friendly target, the falling hammer heals for ${$SPH*$114917m2/1000+26.72716306*$114917m1} over {$114917d=10 seconds}. This healing is a large burst at first, and then decreases over time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.342049
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
exorcism 347 1.5% 10.2 15.17sec 10283 8013 Direct 10.2 8487 16975 9643 13.6% 2.3 2546 5092 13.5%  

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.23 10.23 0.00 0.00 1.2834 0.0000 105221.09 105221.09 0.00 8012.57 8012.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.31 13.54% 5092.43 5092 5092 1342.77 0 5092 1561 1561 0.00
multistrike 1.96 86.46% 2546.22 2546 2546 2196.67 0 2546 4986 4986 0.00
hit 8.84 86.38% 8487.38 8487 8487 8487.38 8487 8487 75022 75022 0.00
crit 1.39 13.62% 16974.77 16975 16975 12949.71 0 16975 23651 23651 0.00
 
DPS Timeline Chart
 

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1280.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:
  • description:Blasts the target with Holy Light, causing {$s1=1} Holy damage and generating 1 Holy Power. Your autoattacks have a {$87138h=20}% chance of resetting the cooldown of your Exorcism.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.686240
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
final_verdict 4331 18.1% 52.4 5.71sec 24813 19625 Direct 52.4 19805 41159 23264 16.2% 11.6 5942 12334 16.2%  

Stats details: final_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.43 52.43 0.00 0.00 1.2644 0.0000 1300845.71 1300845.71 0.00 19624.74 19624.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.88 16.19% 12334.26 10861 15597 10462.32 0 15597 23231 23231 0.00
multistrike 9.75 83.81% 5941.95 5431 7799 5943.82 0 7799 57954 57954 0.00
hit 43.93 83.80% 19804.56 18102 25996 19818.39 18727 20837 870078 870078 0.00
crit 8.49 16.20% 41158.51 36204 51991 41231.94 0 51991 349583 349583 0.00
 
DPS Timeline Chart
 

Action details: final_verdict

Static Values
  • id:157048
  • school:holy
  • resource:holy_power
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5|buff.holy_avenger.up&holy_power>=3
Spelldata
  • id:157048
  • name:Final Verdict
  • school:holy
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
hammer_of_wrath 3612 15.0% 53.0 5.71sec 20340 16549 Direct 53.0 15841 32908 19073 18.9% 11.8 4751 9878 18.9%  

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.05 53.03 0.00 0.00 1.2291 0.0000 1079005.46 1079005.46 0.00 16548.66 16548.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.23 18.87% 9877.65 7656 11485 8788.98 0 11485 22004 22004 0.00
multistrike 9.58 81.13% 4751.01 3828 5742 4751.65 0 5742 45514 45514 0.00
hit 42.99 81.07% 15841.42 12759 19141 15848.24 14916 16738 681065 681065 0.00
crit 10.04 18.93% 32908.41 25518 38282 32946.68 0 38282 330423 330423 0.00
 
DPS Timeline Chart
 

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a magical hammer that strikes an enemy for {$s1=1} Holy damage{$?s53503=false}[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health{$?s53503=false}[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.028000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
hand_of_light 5635 23.6% 223.4 1.64sec 7563 0 Direct 223.4 7563 0 7563 0.0% 0.0 0 0 0.0%  

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.43 223.43 0.00 0.00 0.0000 0.0000 1689852.34 1689852.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.43 100.00% 7563.32 920 27081 7576.50 6655 8831 1689852 1689852 0.00
 
DPS Timeline Chart
 

Action details: hand_of_light

Static Values
  • id:96172
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12759.20
  • base_dd_max:12759.20
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
judgment 1109 4.7% 34.4 7.77sec 9729 7517 Direct 34.4 8011 16031 9121 13.8% 7.6 2403 4810 13.8%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.35 34.35 0.00 0.00 1.2942 0.0000 334219.76 334219.76 0.00 7517.14 7517.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.05 13.80% 4809.60 4802 5762 3113.22 0 5762 5067 5067 0.00
multistrike 6.58 86.20% 2403.10 2401 2881 2399.48 0 2641 15807 15807 0.00
hit 29.60 86.16% 8010.93 8003 9604 8010.84 8003 8092 237117 237117 0.00
crit 4.76 13.84% 16030.96 16007 19208 15903.39 0 19208 76229 76229 0.00
 
DPS Timeline Chart
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.empowered_seals.enabled&time<2
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Causes {$s1=1} Holy damage {$?s105424=false}[and generates 1 Holy Power]?s85256[and generates 1 Holy Power][]. Requires an active Seal to cast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.696000
  • spell_power_mod.direct:0.576000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 2369 9.9% 99.0 3.03sec 7188 2374 Direct 99.0 5739 11936 6738 16.1% 22.0 1722 3579 16.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.03 99.03 0.00 0.00 3.0277 0.0000 711787.43 1093904.90 34.93 2373.94 2373.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.56 16.16% 3578.86 3155 4545 3479.04 0 4545 12742 19582 33.92
multistrike 18.47 83.84% 1721.79 1578 2272 1723.03 1578 2051 31808 48884 34.93
hit 83.06 83.88% 5738.62 5259 7574 5742.93 5533 5960 476677 732578 34.93
crit 15.97 16.12% 11935.84 10517 15149 11952.74 10517 14377 190560 292861 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
seal_of_truth_proc 1339 5.6% 300.3 1.00sec 1339 0 Direct 300.3 1066 2220 1255 16.4% 66.8 320 666 16.4%  

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 300.26 300.26 0.00 0.00 0.0000 0.0000 401918.14 401918.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.94 16.38% 665.82 582 838 666.37 582 838 7287 7287 0.00
multistrike 55.86 83.62% 319.83 291 419 320.09 298 353 17866 17866 0.00
hit 251.12 83.64% 1066.02 970 1397 1066.87 1038 1098 267703 267703 0.00
crit 49.13 16.36% 2219.70 1940 2794 2222.20 2022 2490 109062 109062 0.00
 
DPS Timeline Chart
 

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.12
 
shattered_bleed 387 1.6% 17.6 17.40sec 6623 0 Direct 17.6 1636 3338 1910 16.1% 3.9 491 1002 16.1%  
Periodic 98.2 769 0 769 0.0% 21.9 233 0 0.0% 32.6%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.58 17.58 98.17 98.17 0.0000 1.0000 116424.90 116424.90 0.00 1185.94 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.63 16.06% 1002.13 934 1121 464.31 0 1121 630 630 0.00
multistrike 3.29 83.94% 490.82 467 560 471.24 0 560 1614 1614 0.00
hit 14.74 83.88% 1635.59 1557 1868 1635.33 1557 1799 24116 24116 0.00
crit 2.83 16.12% 3337.72 3113 3736 3154.78 0 3736 9459 9459 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 21.9 100.00% 233.48 233 233 233.48 233 233 5112 5112 0.00
hit 98.2 100.00% 768.99 1 778 769.27 733 778 75493 75493 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Ðepeche
avenging_wrath 3.0 120.90sec

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 2.98 2.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.37 79.53% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.61 20.47% 0.00 0 0 0.00 0 0 0 0 0.00
 
HPS Timeline Chart
 

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:119.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ðepeche
  • harmful:false
  • if_expr:talent.seraphim.enabled
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
 
draenic_strength_potion 2.0 0.00sec

Stats details: draenic_strength_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156428
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156428
  • name:Draenic Strength Potion
  • school:physical
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
avenging_wrath 3.0 0.0 120.9sec 120.9sec 28.24% 68.65% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • avenging_wrath_1:28.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_crusader 16.1 1.0 17.6sec 16.5sec 16.50% 100.00% 1.0(1.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_divine_crusader
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_crusader_1:16.50%

Trigger Attempt Success

  • trigger_pct:24.77%

Spelldata details

  • id:144595
  • name:Divine Crusader
  • tooltip:Your next Divine Storm is free and deals {$s2=50}% more damage.
  • description:{$@spelldesc144593=Holy Power consumers have a 25% chance to make your next Divine Storm free and deal {$144595s2=50}% more damage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_strength_potion 2.0 0.0 122.2sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
final_verdict 16.7 47.4 17.8sec 4.7sec 75.03% 75.03% 47.4(47.4)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • final_verdict_1:75.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157048
  • name:Final Verdict
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
glyph_double_jeopardy (glyph_double_jeopardy) 4.2 37.8 73.0sec 6.3sec 71.17% 71.18% 37.8(37.8)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_glyph_double_jeopardy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • glyph_double_jeopardy_1:71.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:54922
  • name:Glyph of Double Jeopardy
  • tooltip:
  • description:Judging a target increases the damage of your next Judgment by {$121027s1=20}%, but only if used on a different second target.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
selfless_healer 2.7 39.3 119.2sec 6.3sec 75.30% 75.30% 34.0(34.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_selfless_healer
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • selfless_healer_1:3.92%
  • selfless_healer_2:4.14%
  • selfless_healer_3:67.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114250
  • name:Selfless Healer
  • tooltip:Your next Flash of Light casts $w1% faster, costs $w3% less mana, and heals for $w2% greater effectiveness on others.
  • description:{$@spelldesc85804=Your successful Judgments reduce the cast time and mana cost of your next Flash of Light by {$114250s1=35}%, and increase its effect on others by $?c1[{$114250s4=35}][{$114250s2=20}]%. Stacks up to 3 times.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
spirit_of_the_warlords 3.0 0.0 120.5sec 120.5sec 19.00% 19.01% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
seal_of_truth

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_seal_of_truth
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • seal_of_truth_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31801
  • name:Seal of Truth
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ðepeche
crusader_strike Mana 61.4 39294.0 640.0 640.0 12.3
execution_sentence Mana 5.5 22469.5 4096.0 4095.9 16.0
exorcism Mana 10.2 13097.8 1280.0 1280.0 8.0
final_verdict Holy Power 52.4 157.3 3.0 3.0 8270.9
hammer_of_wrath Mana 53.0 50926.8 960.0 960.0 21.2
Resource Gains Type Count Total Average Overflow
external_healing Health 8.83 0.00 (0.00%) 0.00 81588.16 100.00%
sword_of_light Mana 149.64 124845.05 (100.00%) 834.29 162468.69 56.55%
crusader_strike Holy Power 61.40 61.40 (38.61%) 1.00 0.00 0.00%
exorcism Holy Power 10.23 10.23 (6.43%) 1.00 0.00 0.00%
hammer_of_wrath Holy Power 53.03 53.03 (33.35%) 1.00 0.00 0.00%
judgment Holy Power 34.35 34.35 (21.60%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 414.90 418.04
Holy Power 0.53 0.52
Combat End Resource Mean Min Max
Mana 31074.78 26944.00 32000.00
Holy Power 1.75 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 32.3%

Procs

Count Interval
divine_crusader 17.1 16.5sec
exorcism_cd_reset 19.8 14.6sec
wasted_exorcism_cd_reset 13.7 21.5sec

Statistics & Data Analysis

Fight Length
Sample Data Ðepeche Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Ðepeche Damage Per Second
Count 25000
Mean 23903.58
Minimum 21207.24
Maximum 26867.53
Spread ( max - min ) 5660.29
Range [ ( max - min ) / 2 * 100% ] 11.84%
Standard Deviation 771.3699
5th Percentile 22657.66
95th Percentile 25187.02
( 95th Percentile - 5th Percentile ) 2529.36
Mean Distribution
Standard Deviation 4.8786
95.00% Confidence Intervall ( 23894.02 - 23913.14 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4000
0.1 Scale Factor Error with Delta=300 5079
0.05 Scale Factor Error with Delta=300 20317
0.01 Scale Factor Error with Delta=300 507936
Distribution Chart
DPS(e)
Sample Data Ðepeche Damage Per Second (Effective)
Count 25000
Mean 23903.58
Minimum 21207.24
Maximum 26867.53
Spread ( max - min ) 5660.29
Range [ ( max - min ) / 2 * 100% ] 11.84%
Damage
Sample Data Ðepeche Damage
Count 25000
Mean 7173167.35
Minimum 5306175.77
Maximum 9039919.62
Spread ( max - min ) 3733743.85
Range [ ( max - min ) / 2 * 100% ] 26.03%
DTPS
Sample Data Ðepeche Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ðepeche Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ðepeche Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ðepeche Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ðepeche Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ðepeche Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ÐepecheTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ðepeche Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=sleeper_surprise
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up
4 0.00 seal_of_truth,if=active_enemies<2
5 0.00 seal_of_righteousness,if=active_enemies>=2
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_strength
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 rebuke
9 1.00 potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
A 1.00 auto_attack
B 0.00 speed_of_light,if=movement.distance>5
C 0.00 judgment,if=talent.empowered_seals.enabled&time<2
D 5.49 execution_sentence
E 0.00 lights_hammer
F 0.00 holy_avenger,sync=seraphim,if=talent.seraphim.enabled
G 0.00 holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
H 0.00 avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
I 2.98 avenging_wrath,if=!talent.seraphim.enabled
J 0.00 blood_fury
K 0.00 berserking
L 0.00 arcane_torrent
M 0.00 seraphim
N 0.00 wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
O 0.00 call_action_list,name=aoe,if=active_enemies>=5
P 0.00 call_action_list,name=cleave,if=active_enemies>=3
Q 0.00 call_action_list,name=single
actions.single
# count action,conditions
R 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
S 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
T 0.00 divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
U 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
V 0.00 templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
W 0.00 templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
X 0.00 divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
Y 1.45 final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
Z 0.00 final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
a 53.05 hammer_of_wrath
b 0.00 judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
c 0.00 judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
d 0.00 exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
e 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
f 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
g 9.28 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
h 30.95 final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
i 0.00 templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
j 61.40 crusader_strike,if=holy_power<5
k 0.00 divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
l 6.65 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
m 0.00 final_verdict,if=buff.divine_purpose.react
n 8.40 final_verdict,if=holy_power>=4
o 1.00 judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
p 0.00 exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
q 33.35 judgment,,if=holy_power<5
r 11.63 final_verdict,if=holy_power>=3
s 0.00 exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
t 0.00 templars_verdict,if=buff.divine_purpose.react
u 0.00 divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
v 0.00 templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
w 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
x 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
y 10.23 exorcism,if=holy_power<5
z 0.00 templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
{ 0.00 holy_prism

Sample Sequence

0147ADIajahajahajahajahajahajahagajahjlojnljqrjlqjryjqrjyqjnDjqrjyqjnljqrjyqjnljqrjlqjrljqyjnqjrqjyqjYljDI9ahagahajahagajahajahajanjqrjyqjnqjryjqrjlqjrDjqyjaYgjahjqahgjahgjaqhjaqhjaqhgajqhagjqahjqaDIhjahajahajahagajahajahajahjqahjqahgjahjqah

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre seal_of_truth Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power draenic_strength_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:00.000 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:01.316 avenging_wrath Ðepeche 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, draenic_strength_potion
0:01.316 hammer_of_wrath Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, draenic_strength_potion
0:02.329 crusader_strike Fluffy_Pillow 28864.0/32000: 90% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, draenic_strength_potion
0:03.341 hammer_of_wrath Fluffy_Pillow 28224.0/32000: 88% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, draenic_strength_potion
0:04.353 final_verdict Fluffy_Pillow 29184.0/32000: 91% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, draenic_strength_potion
0:05.365 hammer_of_wrath Fluffy_Pillow 29184.0/32000: 91% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:06.378 crusader_strike Fluffy_Pillow 30144.0/32000: 94% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:07.392 hammer_of_wrath Fluffy_Pillow 29504.0/32000: 92% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:08.404 final_verdict Fluffy_Pillow 30464.0/32000: 95% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:09.417 hammer_of_wrath Fluffy_Pillow 30464.0/32000: 95% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:10.429 crusader_strike Fluffy_Pillow 31424.0/32000: 98% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:11.443 hammer_of_wrath Fluffy_Pillow 30784.0/32000: 96% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:12.456 final_verdict Fluffy_Pillow 31744.0/32000: 99% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:13.468 hammer_of_wrath Fluffy_Pillow 31744.0/32000: 99% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:14.482 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:15.495 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:16.507 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:17.519 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:18.532 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:19.545 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:20.556 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords
0:21.568 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords
0:22.580 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords
0:23.593 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords
0:24.606 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords
0:25.618 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader
0:26.631 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader
0:27.644 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, divine_crusader
0:28.657 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, divine_crusader
0:29.669 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, divine_crusader
0:30.682 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, avenging_wrath, divine_crusader
0:31.694 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, divine_crusader
0:32.705 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, divine_crusader
0:33.717 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, divine_crusader
0:34.729 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, selfless_healer(2), divine_crusader
0:35.741 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power bloodlust, glyph_double_jeopardy, selfless_healer(2), divine_crusader
0:36.753 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2), divine_crusader
0:37.767 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, selfless_healer(2), divine_crusader
0:38.781 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, selfless_healer(2), divine_crusader
0:39.795 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, selfless_healer(3), divine_crusader
0:40.806 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
0:41.817 divine_storm Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
0:43.130 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
0:44.446 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
0:45.761 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
0:47.077 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:48.391 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:49.706 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:51.019 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:52.335 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:53.649 exorcism Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:54.965 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:56.280 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:57.596 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:58.910 Waiting 1.100 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:00.010 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:01.326 crusader_strike Fluffy_Pillow 27904.0/32000: 87% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:02.641 judgment Fluffy_Pillow 29184.0/32000: 91% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:03.955 final_verdict Fluffy_Pillow 29184.0/32000: 91% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:05.270 crusader_strike Fluffy_Pillow 31104.0/32000: 97% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:06.585 Waiting 0.200 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:06.785 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:08.098 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:09.414 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:10.729 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:12.045 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:13.360 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
1:14.676 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
1:15.989 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
1:17.303 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:18.618 Waiting 0.500 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:19.118 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:20.432 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:21.748 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:23.061 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:24.377 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:25.692 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
1:27.006 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
1:28.321 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
1:29.633 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:30.946 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:32.262 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
1:33.576 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
1:34.891 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
1:36.207 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:37.521 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3)
1:38.835 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
1:40.150 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
1:41.464 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
1:42.779 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3)
1:44.095 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:45.411 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:46.724 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:48.038 Waiting 1.300 sec 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:49.338 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:50.652 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:51.965 Waiting 1.300 sec 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:53.265 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:54.581 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:55.896 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:57.210 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:58.523 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:59.838 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
2:01.152 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
2:02.467 avenging_wrath Ðepeche 29824.0/32000: 93% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
2:02.467 potion Fluffy_Pillow 29824.0/32000: 93% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader
2:02.467 hammer_of_wrath Fluffy_Pillow 29824.0/32000: 93% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
2:03.782 final_verdict Fluffy_Pillow 28864.0/32000: 90% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
2:05.097 hammer_of_wrath Fluffy_Pillow 30784.0/32000: 96% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:06.412 divine_storm Fluffy_Pillow 31744.0/32000: 99% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:07.727 hammer_of_wrath Fluffy_Pillow 31744.0/32000: 99% mana | 2.0/5: 40% holy_power selfless_healer(3), avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:09.040 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3), avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:10.354 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:11.669 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:12.985 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:14.299 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:15.614 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:16.931 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:18.243 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:19.558 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:20.870 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:22.185 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:23.500 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:24.812 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, draenic_strength_potion
2:26.128 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath, draenic_strength_potion
2:27.442 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power final_verdict, avenging_wrath, draenic_strength_potion
2:28.757 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath
2:30.071 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath
2:31.385 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath
2:32.699 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict
2:34.014 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict
2:35.328 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict
2:36.643 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
2:37.957 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
2:39.271 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
2:40.585 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
2:41.899 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
2:43.214 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
2:44.530 Waiting 1.300 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
2:45.830 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
2:47.144 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:48.460 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:49.775 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:51.089 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:52.404 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:53.719 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:55.032 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
2:56.348 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
2:57.661 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
2:58.975 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
3:00.291 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
3:01.604 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:02.918 crusader_strike Fluffy_Pillow 29824.0/32000: 93% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:04.233 judgment Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:05.547 exorcism Fluffy_Pillow 31104.0/32000: 97% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:06.861 crusader_strike Fluffy_Pillow 31744.0/32000: 99% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:08.175 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:09.488 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 5.0/5: 100% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:10.803 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:12.119 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
3:13.434 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
3:14.748 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power selfless_healer(3)
3:16.062 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:17.375 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:18.689 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:20.004 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:21.318 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:22.632 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
3:23.945 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
3:25.259 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
3:26.575 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:27.890 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power selfless_healer(3)
3:29.205 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
3:30.519 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
3:31.834 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
3:33.148 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:34.462 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:35.776 judgment Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:37.091 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:38.407 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:39.720 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:41.035 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:42.349 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:43.664 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:44.978 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
3:46.293 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
3:47.608 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
3:48.923 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
3:50.238 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:51.552 divine_storm Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:52.867 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
3:54.181 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
3:55.495 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
3:56.809 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3)
3:58.123 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:59.439 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:00.754 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), spirit_of_the_warlords
4:02.067 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), spirit_of_the_warlords
4:03.383 avenging_wrath Ðepeche 27904.0/32000: 87% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), spirit_of_the_warlords
4:03.383 final_verdict Fluffy_Pillow 27904.0/32000: 87% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:04.698 crusader_strike Fluffy_Pillow 29824.0/32000: 93% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:06.012 hammer_of_wrath Fluffy_Pillow 31104.0/32000: 97% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:07.328 final_verdict Fluffy_Pillow 30144.0/32000: 94% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:08.643 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:09.958 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:11.273 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:12.586 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:13.900 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:15.214 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:16.528 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:17.842 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:19.157 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, avenging_wrath, divine_crusader, spirit_of_the_warlords
4:20.471 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, divine_crusader
4:21.785 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power avenging_wrath
4:23.099 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power avenging_wrath
4:24.413 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power avenging_wrath
4:25.726 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power avenging_wrath
4:27.041 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath
4:28.356 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath
4:29.670 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath
4:30.985 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, avenging_wrath
4:32.299 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath
4:33.611 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power final_verdict
4:34.925 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict
4:36.240 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict
4:37.554 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict
4:38.869 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict
4:40.185 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:41.501 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:42.817 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:44.131 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:45.446 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
4:46.761 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
4:48.078 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2), divine_crusader
4:49.391 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(2)
4:50.706 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(2)
4:52.020 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(2)
4:53.334 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
4:54.646 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(2)
4:55.960 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:57.275 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4409 3936 3822 (1414)
Agility 477 455 455
Stamina 4222 3839 3839
Intellect 1094 1042 1042
Spirit 782 782 782
Health 253320 230340 0
Mana 32000 32000 0
Holy Power 5 5 0
Spell Power 4850 3936 0
Crit 16.59% 11.59% 725
Haste 14.44% 8.99% 899
Multistrike 11.12% 6.12% 404
Damage / Heal Versatility 3.77% 0.77% 100
Attack Power 4850 3936 0
Mastery 52.09% 38.14% 985
Armor 1931 1931 1931

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Blinding Light
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence
100 Empowered Seals Seraphim Final Verdict (Retribution Paladin)

Profile

paladin="Ðepeche"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ðepeche/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/95/55886431-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=jewelcrafting=700/blacksmithing=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!2001122
glyphs=hand_of_sacrifice/double_jeopardy/templars_verdict/seal_of_blood/winged_vengeance/righteous_retreat
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up
actions.precombat+=/seal_of_truth,if=active_enemies<2
actions.precombat+=/seal_of_righteousness,if=active_enemies>=2
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_strength

# Executed every time the actor is available.

actions=rebuke
actions+=/potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
actions+=/auto_attack
actions+=/speed_of_light,if=movement.distance>5
actions+=/judgment,if=talent.empowered_seals.enabled&time<2
actions+=/execution_sentence
actions+=/lights_hammer
actions+=/holy_avenger,sync=seraphim,if=talent.seraphim.enabled
actions+=/holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
actions+=/avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
actions+=/avenging_wrath,if=!talent.seraphim.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/seraphim
actions+=/wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
actions+=/call_action_list,name=aoe,if=active_enemies>=5
actions+=/call_action_list,name=cleave,if=active_enemies>=3
actions+=/call_action_list,name=single

actions.single=divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
actions.single+=/templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
actions.single+=/templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
actions.single+=/final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
actions.single+=/final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
actions.single+=/hammer_of_wrath
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
actions.single+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
actions.single+=/final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
actions.single+=/templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.single+=/crusader_strike,if=holy_power<5
actions.single+=/divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
actions.single+=/final_verdict,if=buff.divine_purpose.react
actions.single+=/final_verdict,if=holy_power>=4
actions.single+=/judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
actions.single+=/exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
actions.single+=/judgment,,if=holy_power<5
actions.single+=/final_verdict,if=holy_power>=3
actions.single+=/exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
actions.single+=/templars_verdict,if=buff.divine_purpose.react
actions.single+=/divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
actions.single+=/templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
actions.single+=/exorcism,if=holy_power<5
actions.single+=/templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
actions.single+=/holy_prism

actions.cleave=final_verdict,if=buff.final_verdict.down&holy_power=5
actions.cleave+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)&!talent.final_verdict.enabled
actions.cleave+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.cleave+=/hammer_of_wrath
actions.cleave+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.cleave+=/divine_storm,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)&!talent.final_verdict.enabled
actions.cleave+=/crusader_strike
actions.cleave+=/divine_storm,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)&!talent.final_verdict.enabled
actions.cleave+=/final_verdict,if=buff.final_verdict.down
actions.cleave+=/divine_storm,if=buff.final_verdict.up
actions.cleave+=/exorcism,if=glyph.mass_exorcism.enabled
actions.cleave+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.cleave+=/judgment
actions.cleave+=/exorcism

actions.aoe=divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)
actions.aoe+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.aoe+=/hammer_of_wrath
actions.aoe+=/hammer_of_the_righteous
actions.aoe+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.aoe+=/divine_storm,if=(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.aoe+=/exorcism,if=glyph.mass_exorcism.enabled
actions.aoe+=/holy_prism,target=self
actions.aoe+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.aoe+=/judgment
actions.aoe+=/exorcism

head=bouldercrush_helm,id=118949,bonus_id=31/560
neck=spirewalkers_chain,id=114540,bonus_id=134,enchant=40mastery
shoulders=primal_gladiators_scaled_shoulders,id=115700
back=cloak_of_ruminant_deception,id=113830,bonus_id=566,enchant=gift_of_mastery
chest=rivetsealed_breastplate,id=109896,bonus_id=524
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=bouldercrush_vambraces,id=118954,bonus_id=78
hands=exceptional_crystalplated_gauntlets,id=115390
waist=fleshchewer_greatbelt,id=113659
legs=rivetsealed_legplates,id=109822,bonus_id=524
feet=crazed_bombers_greaves,id=114504,bonus_id=487
finger1=grunts_solid_signet,id=113599,bonus_id=566,enchant=50mastery
finger2=timeless_solium_band_of_brutality,id=118295,enchant=50mastery
trinket1=skull_of_war,id=112318,bonus_id=525/530
trinket2=mote_of_corruption,id=110010,bonus_id=524
main_hand=blood_gutter_greatsword,id=115418,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_strength=2295
# gear_stamina=2949
# gear_crit_rating=725
# gear_haste_rating=899
# gear_mastery_rating=938
# gear_armor=1931
# gear_multistrike_rating=404

Swæty

Swæty : 21427 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
21426.6 21426.6 6.7 / 0.031% 2134.5 / 10.0% 53.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
391.0 391.0 Mana 0.00% 40.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Swæty/advanced
Talents
  • 15: Angelic Bulwark
  • 30: Body and Soul
  • 45: Insanity (Shadow Priest)
  • 60: Dominate Mind
  • 75: Shadowy Insight (Shadow Priest)
  • 90: Halo (Shadow Priest)
  • 100: Clarity of Power (Shadow Priest)
  • Talent Calculator
Glyphs
  • Glyph of Fade
  • Glyph of Mind Blast
  • Glyph of Mind Flay
  • Glyph of Dark Archangel
  • Glyph of the Heavens
  • Glyph of Shadow Ravens
Professions
  • mining: 700
  • enchanting: 679

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Sw%C3%A6ty+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:41199|27991|26282|23335|22736|21697|15226|13628&chds=0,82397&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++41199++devouring_plague,9482C9,0,0,15|t++27991++shadow_word_pain,9482C9,1,0,15|t++26282++shadow_word_death,9482C9,2,0,15|t++23335++halo,9482C9,3,0,15|t++22736++mind_blast,9482C9,4,0,15|t++21697++vampiric_touch,9482C9,5,0,15|t++15226++mind_spike,4A79D3,6,0,15|t++13628++insanity,9482C9,7,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Sw%C3%A6ty+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:27,20,15,10,9,7,4,3,3,2,2,1&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9&chl=mind_blast|mind_spike|insanity|devouring_plague|devouring_plague_tick|shadow_word_death|shadow_word_pain|vampiric_touch|halo_damage|shadowfiend: melee|shattered_bleed|shadowy_apparitions&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Sw%C3%A6ty+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:knrwxz27772535525530241y01zwy120yzyvsqrqomooonpoomoqqonpqrqpppponllllkjhijjjkkllnmmnoppppqrrqppponnmmmljjjijkkklmmmnnnooooppqpppoonmmmllkkjkkkllmmmmnnnooooopppooonnmmlllkkkjkklllmnnnopppqqqrsssssssrrrqqqqppqqqqrrrrrrrsssssttttttsssssrrrrrrrrsssssttttttuuuuuvvvvvvvvvvvvvvvvvvwwwwwwxxxxxxxxxyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzzyyyyyxxxwwvvvuuttssrrqqponmkigdbZXVTRP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.735071,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=21427|max=29149&chxp=1,1,74,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Sw%C3%A6ty+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,4,0,9,5,27,46,83,138,269,319,483,617,767,948,1175,1410,1511,1602,1676,1649,1599,1513,1415,1279,1148,1000,851,766,568,527,409,309,229,157,138,109,71,59,38,26,12,14,11,4,4,1,1,0,1&chds=0,1676&chbh=5&chxt=x&chxl=0:|min=19537|avg=21427|max=23986&chxp=0,1,42,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Sw%C3%A6ty+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:28.0,24.7,22.4,9.6,5.2,3.3,3.2,2.9,0.8&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_spike 84.3s|mind_blast 74.3s|insanity 67.4s|devouring_plague 29.0s|shadow_word_death 15.6s|shadow_word_pain 9.9s|vampiric_touch 9.7s|halo 8.7s|shadowfiend 2.4s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Swæty 21427
devouring_plague 2000 (3965) 9.3% (18.5%) 22.0 13.15sec 54329 41199 Direct 22.0 21604 43203 25655 18.8% 5.0 6481 12973 18.8%  

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.96 21.96 0.00 0.00 1.3187 0.0000 601544.86 601544.86 0.00 41198.64 41198.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.93 18.82% 12973.16 12566 15435 7867.81 0 15435 12127 12127 0.00
multistrike 4.03 81.18% 6481.09 6283 7717 6383.21 0 7717 26142 26142 0.00
hit 17.84 81.24% 21603.53 20943 25725 21616.34 20943 22736 385354 385354 0.00
crit 4.12 18.76% 43203.37 41887 51449 42672.77 0 51449 177921 177921 0.00
 
DPS Timeline Chart
 

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=5&talent.surge_of_darkness.enabled
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:
  • description:Consumes 3 Shadow Orbs to deal {$s1=2869} Shadow damage and then an additional {$s2=100}% of the initial damage over {$158831d=6 seconds}. Heals the caster for {$s3=100}% of damage done.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    devouring_plague_tick 1965 9.2% 26.9 10.64sec 21961 0 Periodic 160.9 3675 0 3675 0.0% 0.0 0 0 0.0% 39.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.92 0.00 133.99 160.91 0.0000 0.8758 591279.45 0.00 0.00 5039.11 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.9 100.00% 3674.58 0 11760 3676.73 3033 5007 591279 0 0.00
 
DPS Timeline Chart
 

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:
  • description:Consumes 3 Shadow Orbs to deal {$s1=2869} Shadow damage and then an additional {$s2=100}% of the initial damage over {$158831d=6 seconds}. Heals the caster for {$s3=100}% of damage done.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
halo 0 (678) 0.0% (3.2%) 6.7 48.05sec 30386 23335

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 6.70 0.00 0.00 1.3022 0.0000 0.00 0.00 0.00 23334.93 23334.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.45 81.39% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.25 18.61% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled&target.distance<=30&active_enemies>2
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s1=3120} Shadow damage to enemies, with the greatest effect at 25 yds.
 
    halo_damage 678 3.2% 6.7 48.05sec 30386 0 Direct 6.7 23992 47922 28451 18.6% 1.5 7193 14391 18.6%  

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 6.70 0.00 0.00 0.0000 0.0000 203527.29 203527.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.28 18.62% 14390.88 13670 16791 3568.01 0 16791 4070 4070 0.00
multistrike 1.24 81.38% 7192.95 6835 8396 5209.12 0 8396 8890 8890 0.00
hit 5.45 81.36% 23991.87 22783 27986 24027.83 22783 27986 130751 130751 0.00
crit 1.25 18.64% 47922.16 45566 55971 35672.32 0 55971 59817 59817 0.00
 
DPS Timeline Chart
 

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s1=3120} Shadow damage to enemies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.264000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
insanity 3053 14.3% 35.4 7.85sec 25960 13628 Periodic 95.2 7611 15223 9036 18.7% 21.6 2283 4568 18.7% 20.7%

Stats details: insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.38 35.38 95.18 95.18 1.9049 0.6534 918475.71 918475.71 0.00 13628.45 13628.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.0 18.74% 4568.18 4491 5517 4479.48 0 5517 18445 18445 0.00
multistrike 17.5 81.26% 2283.40 2246 2759 2284.36 2246 2539 39990 39990 0.00
hit 77.4 81.29% 7611.29 7486 9195 7614.29 7486 7844 588921 588921 0.00
crit 17.8 18.71% 15222.80 14972 18390 15228.57 14972 17251 271119 271119 0.00
 
DPS Timeline Chart
 

Action details: insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2
Spelldata
  • id:129197
  • name:Insanity
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted {$120587s1=15}% increased movement speed for {$120587d=5 seconds}, stacking up to {$120587u=3} times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
mind_blast 5621 26.2% 57.2 5.30sec 29547 22736 Direct 57.2 23311 46627 27671 18.7% 12.9 6992 13983 18.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.17 57.17 0.00 0.00 1.2996 0.0000 1689092.95 1689092.95 0.00 22736.17 22736.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.42 18.76% 13983.07 13476 16553 12702.87 0 16553 33871 33871 0.00
multistrike 10.49 81.24% 6992.07 6738 8276 6996.76 6738 8276 73346 73346 0.00
hit 46.48 81.30% 23311.28 22460 27588 23324.88 22673 24062 1083415 1083415 0.00
crit 10.69 18.70% 46626.55 44920 55176 46648.28 0 55176 498461 498461 0.00
 
DPS Timeline Chart
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:6.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:glyph.mind_harvest.enabled&shadow_orb<=2&active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=1722} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.{$?s162532=false}[ The first time you hit an enemy with Mind Blast, you gain {$162532s1=2} additional $LOrb:Orbs;.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mind_spike 4274 19.9% 67.5 4.37sec 19016 15226 Direct 67.5 15001 30016 17805 18.7% 15.3 4501 9000 18.6%  

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.49 67.49 0.00 0.00 1.2489 0.0000 1283325.77 1283325.77 0.00 15226.39 15226.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.84 18.56% 8999.86 6177 10622 8455.93 0 10622 25566 25566 0.00
multistrike 12.47 81.44% 4500.99 3089 5311 4503.32 3830 5311 56108 56108 0.00
hit 54.88 81.32% 15001.07 10295 17704 15009.34 14430 15667 823318 823318 0.00
crit 12.60 18.68% 30016.12 20591 35408 30033.90 24709 35408 378334 378334 0.00
 
DPS Timeline Chart
 

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:191.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=790} Shadowfrost damage, but extinguishes your damage over time effects on the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.825000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shadow_word_death 1366 6.4% 11.6 5.36sec 35440 26282 Direct 11.6 27973 55957 33194 18.7% 2.6 8397 16823 18.8%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.60 11.60 0.00 0.00 1.3485 0.0000 411043.36 411048.26 0.00 26281.54 26281.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.49 18.78% 16823.49 11308 19446 6565.58 0 19446 8247 8247 0.00
multistrike 2.12 81.22% 8397.11 5654 9723 7453.16 0 9723 17805 17806 0.00
hit 9.43 81.35% 27973.41 18846 32410 28005.74 21862 32410 263924 263927 0.00
crit 2.16 18.65% 55957.02 37693 64820 50731.23 0 64820 121068 121069 0.00
 
DPS Timeline Chart
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:800.0
  • cooldown:8.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<20&shadow_orb<=4
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=1548} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}&!s157218[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shadow_word_pain 799 (925) 3.7% (4.3%) 7.6 30.52sec 36404 27991 Direct 7.6 3414 6832 4053 18.7% 1.7 1025 2045 19.0%  
Periodic 50.9 3202 6401 3799 18.7% 11.6 995 1991 18.6% 44.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.64 7.64 50.94 50.94 1.3006 2.6036 240191.74 240191.74 0.00 1950.69 27991.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.32 18.98% 2045.48 1990 2444 572.57 0 2444 664 664 0.00
multistrike 1.39 81.02% 1024.72 995 1222 778.94 0 1222 1420 1420 0.00
hit 6.21 81.31% 3413.97 3317 4074 3416.17 3317 4074 21202 21202 0.00
crit 1.43 18.69% 6832.47 6633 8148 5368.46 0 8148 9756 9756 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.2 18.60% 1990.92 1990 2444 1750.66 0 2444 4282 4282 0.00
multistrike 9.4 81.40% 995.47 995 1222 995.50 0 1109 9368 9368 0.00
hit 41.4 81.33% 3201.66 267 4074 3202.19 3105 3360 132632 132632 0.00
crit 9.5 18.67% 6401.09 533 8148 6402.05 0 7138 60867 60867 0.00
 
DPS Timeline Chart
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w2 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=455} Shadow damage and an additional $o2 Shadow damage over {$d=18 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.475000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.475000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    shadowy_apparitions 126 0.6% 9.5 22.36sec 3983 0 Direct 9.5 3142 6285 3730 18.7% 2.1 943 1886 18.8%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.51 9.51 0.00 0.00 0.0000 0.0000 37871.03 37871.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.40 18.81% 1885.91 1885 2315 621.76 0 2315 760 760 0.00
multistrike 1.74 81.19% 942.72 942 1157 763.22 0 1157 1641 1641 0.00
hit 7.73 81.29% 3142.29 3141 3858 3141.60 0 3500 24289 24289 0.00
crit 1.78 18.71% 6284.55 6282 7716 5218.78 0 7716 11181 11181 0.00
 
DPS Timeline Chart
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=430} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
shattered_bleed 381 1.8% 17.1 18.00sec 6699 0 Direct 17.1 1578 3156 1872 18.6% 3.9 473 947 18.4%  
Periodic 96.3 780 0 780 0.0% 21.9 237 0 0.0% 32.0%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.08 17.08 96.30 96.30 0.0000 1.0000 114396.36 114396.36 0.00 1187.95 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.71 18.43% 946.66 947 947 481.21 0 947 676 676 0.00
multistrike 3.16 81.57% 473.33 473 473 451.94 0 473 1495 1495 0.00
hit 13.89 81.36% 1577.77 1578 1578 1577.77 1578 1578 21920 21920 0.00
crit 3.18 18.64% 3155.54 3156 3156 3034.49 0 3156 10047 10047 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 21.9 100.00% 236.67 237 237 236.67 237 237 5178 5178 0.00
hit 96.3 100.00% 779.67 1 789 779.95 750 789 75080 75080 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
vampiric_touch 703 3.3% 7.5 31.24sec 28313 21697 Periodic 43.2 3846 7695 4565 18.7% 9.8 1226 2451 18.7% 37.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.47 7.47 43.21 43.21 1.3050 2.6044 211524.55 211524.55 0.00 1729.71 21697.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.8 18.70% 2451.45 2451 3010 2055.57 0 3010 4499 4499 0.00
multistrike 8.0 81.30% 1225.79 1225 1505 1225.28 0 1412 9778 9778 0.00
hit 35.1 81.34% 3846.47 1035 5017 3847.40 3634 4122 135201 135201 0.00
crit 8.1 18.66% 7695.18 2070 10034 7695.36 0 9412 62046 62046 0.00
 
DPS Timeline Chart
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:608.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<(15*0.3+cast_time)&miss_react&active_enemies<=5
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.585000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 5644 / 459
melee 5644 2.1% 20.0 10.60sec 6781 6128 Direct 20.0 5349 10707 6350 18.7% 4.5 1605 3214 18.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 1.1066 0.0000 135755.60 135755.60 0.00 6127.81 6127.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.84 18.50% 3213.75 2513 3549 1830.11 0 3549 2691 2691 0.00
multistrike 3.69 81.50% 1605.10 1256 1775 1572.58 0 1775 5922 5922 0.00
hit 16.28 81.31% 5349.18 4188 5916 5349.32 5013 5868 87083 87083 0.00
crit 3.74 18.69% 10706.71 8376 11832 10543.26 0 11832 40059 40059 0.00
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Swæty
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
shadowfiend 2.0 188.80sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.1944 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.64 81.31% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.38 18.69% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Lasts {$d=12 seconds}.
 
shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.82 81.91% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.18 18.09% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowform

Static Values
  • id:15473
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4160.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:15473
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s3=100}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}% and increasing your armor by {$s3=100}%. However, you may not cast any healing spells while in this form.
 
pet - shadowfiend
shadowcrawl 6.0 40.51sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.01 6.01 0.00 0.00 1.1946 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.89 81.30% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.12 18.70% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 37.51% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 259.4sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
glyph_of_mind_flay 1.0 94.2 0.0sec 2.9sec 92.04% 92.04% 94.2(94.2)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_glyph_of_mind_flay
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • glyph_of_mind_flay_1:92.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120585
  • name:Glyph of Mind Flay
  • tooltip:
  • description:Your Mind Flay spell no longer slows your victim's movement speed. Instead, each time Mind Flay deals damage you will be granted {$120587s1=15}% increased movement speed for {$120587d=5 seconds}, stacking up to {$120587u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 5.9 0.0 11.4sec 11.4sec 16.42% 49.48% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:16.42%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_insanity 22.0 0.0 13.1sec 13.1sec 37.76% 31.29% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadow_word_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_insanity_1:37.76%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowy_insight 5.8 0.1 38.0sec 36.9sec 2.06% 10.05% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadowy_insight
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • shadowy_insight_1:2.06%
  • shadowy_insight_2:0.00%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:162452
  • name:Shadowy Insight
  • tooltip:
  • description:Your Shadow Word: Pain damage over time and Mind Spike damage has a {$s4=5}% chance to reset the cooldown on Mind Blast and make your next Mind Blast instant.
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
(shadowfiend-) shadowfiend-shadowcrawl 6.0 0.0 40.5sec 40.5sec 83.34% 80.01% 0.0(0.0)

Buff details

  • buff initial source:Swæty_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
shadowform

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s3=100}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}% and increasing your armor by {$s3=100}%. However, you may not cast any healing spells while in this form.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Swæty
devouring_plague Shadow Orb 22.0 65.9 3.0 3.0 18109.6
halo Mana 6.7 10716.8 1600.0 1600.0 19.0
insanity Mana 35.4 56608.7 1600.0 1600.0 16.2
mind_blast Mana 57.2 20564.1 359.7 359.7 82.1
mind_spike Mana 67.5 12890.2 191.0 191.0 99.6
shadow_word_death Mana 11.6 9278.5 800.0 800.0 44.3
shadow_word_pain Mana 7.6 3055.3 400.0 400.0 91.0
vampiric_touch Mana 7.5 4542.2 608.0 608.0 46.6
Resource Gains Type Count Total Average Overflow
Devouring Plague Health Health 160.91 0.00 (0.00%) 0.00 1192819.10 100.00%
Shadow Orbs from Mind Blast Shadow Orb 57.17 57.17 (83.13%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 11.60 11.60 (16.87%) 1.00 0.00 0.00%
mp5_regen Mana 200.53 116772.90 (100.00%) 582.31 75295.30 39.20%
Resource RPS-Gain RPS-Loss
Mana 388.07 391.01
Shadow Orb 0.23 0.22
Combat End Resource Mean Min Max
Mana 159124.32 156800.00 160000.00
Shadow Orb 2.90 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 33.9%
shadowfiend-Mana Cap 33.9%
mindbender-Mana Cap 33.9%

Procs

Count Interval
Shadowy Apparition Procced 9.5 22.2sec
Shadowy Insight Mind Blast CD Reset 5.9 37.0sec
Shadowy Insight Mind Blast CD Reset from Mind Spike 3.4 56.7sec
Shadowy Insight Mind Blast CD Reset from Shadow Word: Pain 2.5 52.8sec
Shadowy Insight Mind Blast CD Reset lost to overflow 0.0 93.8sec
Mind Spike removed DoTs 1.6 87.3sec
Mind Spike removed Devouring Plague 0.0 0.0sec
Mind Spike removed Shadow Word: Pain 1.6 87.2sec
Mind Spike removed Vampiric Touch 1.5 84.4sec
Devouring Plague ticks lost from Mind Spike removal 0.0 0.0sec
Shadow Word: Pain ticks lost from Mind Spike removal 3.6 87.2sec
Vampiric Touch ticks lost from Mind Spike removal 2.8 84.4sec

Statistics & Data Analysis

Fight Length
Sample Data Swæty Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Swæty Damage Per Second
Count 25000
Mean 21426.57
Minimum 19536.58
Maximum 23986.18
Spread ( max - min ) 4449.60
Range [ ( max - min ) / 2 * 100% ] 10.38%
Standard Deviation 543.7848
5th Percentile 20581.55
95th Percentile 22366.81
( 95th Percentile - 5th Percentile ) 1785.25
Mean Distribution
Standard Deviation 3.4392
95.00% Confidence Intervall ( 21419.83 - 21433.31 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2474
0.1 Scale Factor Error with Delta=300 2524
0.05 Scale Factor Error with Delta=300 10097
0.01 Scale Factor Error with Delta=300 252428
Distribution Chart
DPS(e)
Sample Data Swæty Damage Per Second (Effective)
Count 25000
Mean 21426.57
Minimum 19536.58
Maximum 23986.18
Spread ( max - min ) 4449.60
Range [ ( max - min ) / 2 * 100% ] 10.38%
Damage
Sample Data Swæty Damage
Count 25000
Mean 6302273.08
Minimum 4681045.17
Maximum 8140088.93
Spread ( max - min ) 3459043.76
Range [ ( max - min ) / 2 * 100% ] 27.44%
DTPS
Sample Data Swæty Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Swæty Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Swæty Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Swæty Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Swæty Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Swæty Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data SwætyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Swæty Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Devouring Plague ticks lost from Mind Spike removal
Sample Data Devouring Plague ticks lost from Mind Spike removal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 1.00
Spread ( max - min ) 1.00
Range [ ( max - min ) / 2 * 100% ] 416666.67%
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_surprise
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 shadowform,if=!buff.shadowform.up
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 mind_spike
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform,if=!buff.shadowform.up
8 1.00 potion,name=draenic_intellect,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 power_infusion,if=talent.power_infusion.enabled
A 0.00 blood_fury
B 0.00 berserking
C 0.00 arcane_torrent
D 0.00 call_action_list,name=pvp_dispersion,if=set_bonus.pvp_2pc
E 0.00 call_action_list,name=decision
actions.cop_dotweave
# count action,conditions
. 7.47 devouring_plague,if=target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&shadow_orb=5&cooldown_react
. 0.00 devouring_plague,if=(buff.mental_instinct.remains<gcd&buff.mental_instinct.remains)
. 6.91 devouring_plague,if=(target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&!buff.shadow_word_insanity.remains&cooldown.mind_blast.remains>0.4*gcd)
. 0.00 mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
. 46.04 mind_blast,if=shadow_orb<=4&cooldown_react
. 1.94 shadowfiend,if=!talent.mindbender.enabled&!buff.shadow_word_insanity.remains
. 0.00 mindbender,if=talent.mindbender.enabled&!buff.shadow_word_insanity.remains
. 0.00 shadow_word_pain,if=shadow_orb=4&set_bonus.tier17_2pc&!target.dot.shadow_word_pain.ticking&!target.dot.devouring_plague.ticking&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
. 7.51 shadow_word_pain,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.shadow_word_pain.ticking
. 7.47 vampiric_touch,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.vampiric_touch.ticking
. 14.53 insanity,if=buff.shadow_word_insanity.remains,chain=1,interrupt_if=cooldown.mind_blast.remains<=0.1
. 0.13 shadow_word_pain,if=shadow_orb>=2&target.dot.shadow_word_pain.remains>=6&cooldown.mind_blast.remains>0.5*gcd&target.dot.vampiric_touch.remains&buff.bloodlust.up&!set_bonus.tier17_2pc
. 0.00 vampiric_touch,if=shadow_orb>=2&target.dot.vampiric_touch.remains>=5&cooldown.mind_blast.remains>0.5*gcd&buff.bloodlust.up&!set_bonus.tier17_2pc
. 5.49 halo,if=cooldown.mind_blast.remains>0.5*gcd&talent.halo.enabled&target.distance<=30&target.distance>=17
. 0.00 divine_star,if=cooldown.mind_blast.remains>0.5&gcd&talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
. 0.00 cascade,if=cooldown.mind_blast.remains>0.5*gcd&talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
. 0.00 shadow_word_pain,if=primary_target=0&(!ticking|remains<=18*0.3),cycle_targets=1,max_cycle_targets=5
. 0.00 vampiric_touch,if=primary_target=0&(!ticking|remains<=15*0.3),cycle_targets=1,max_cycle_targets=5
. 16.36 mind_spike,if=buff.shadow_word_insanity.remains<=gcd&buff.bloodlust.up&!target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains
. 0.10 mind_spike,if=((target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains)|(!target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains))&shadow_orb<=2&cooldown.mind_blast.remains>0.5*gcd
. 0.00 mind_flay,if=set_bonus.tier17_2pc&target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains&cooldown.mind_blast.remains>0.9*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
. 45.20 mind_spike
. 0.00 shadow_word_death,moving=1
. 0.00 halo,if=talent.halo.enabled&target.distance<=30,moving=1
. 0.00 divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
. 0.00 cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
. 0.00 shadow_word_pain,moving=1
actions.cop_mfi
# count action,conditions
. 4.78 devouring_plague,if=shadow_orb=5
. 0.00 mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
. 11.13 mind_blast,if=active_enemies<=5&cooldown_react
. 11.60 shadow_word_death,if=target.health.pct<20,cycle_targets=1
. 2.80 devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<gcd*1.0|target.health.pct<20&cooldown.shadow_word_death.remains<gcd*1.0)
. 0.00 mindbender,if=talent.mindbender.enabled
. 0.07 shadowfiend,if=!talent.mindbender.enabled
. 0.00 shadow_word_pain,if=remains<(18*0.3)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
. 0.00 vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
. 1.39 insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
. 4.46 insanity,if=active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
. 1.21 halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
. 0.00 cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
. 0.00 divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
. 0.00 mind_sear,if=active_enemies>=6,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
. 4.95 mind_spike
. 0.00 shadow_word_death,moving=1
. 0.00 mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
. 0.00 halo,if=talent.halo.enabled&target.distance<=30,moving=1
. 0.00 divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
. 0.00 cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
. 0.00 shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

Sample Sequence

01356............................................................................................................................................................................8...........................

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre shadowform Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:00.000 mind_spike Fluffy_Pillow 159809.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:00.000 mind_blast Fluffy_Pillow 159809.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:01.349 shadowfiend Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:02.388 halo Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:03.427 mind_spike Fluffy_Pillow 159065.0/160000: 99% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:04.465 mind_spike Fluffy_Pillow 159538.3/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:05.503 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:06.541 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:07.579 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:08.616 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:09.654 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:10.693 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:11.732 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:12.771 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:13.810 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:14.848 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:15.885 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:16.924 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:17.962 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:18.999 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust, draenic_intellect_potion
0:20.038 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust
0:21.077 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust
0:22.115 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, shadow_word_insanity
0:23.153 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, shadow_word_insanity
0:26.463 mind_blast Fluffy_Pillow 158918.4/160000: 99% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:27.501 devouring_plague Fluffy_Pillow 159182.7/160000: 99% mana | 4.0/5: 80% shadow_orb bloodlust, glyph_of_mind_flay
0:28.540 insanity Fluffy_Pillow 159847.7/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, shadow_word_insanity, glyph_of_mind_flay
0:30.421 mind_blast Fluffy_Pillow 159451.5/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, shadow_word_insanity, glyph_of_mind_flay
0:31.460 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, shadow_word_insanity, glyph_of_mind_flay
0:33.825 mind_spike Fluffy_Pillow 159913.6/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:34.861 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:35.899 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:36.937 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:37.975 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:39.013 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:40.051 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, glyph_of_mind_flay
0:41.088 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:42.436 halo Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:43.784 mind_blast Fluffy_Pillow 159262.7/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:45.132 shadow_word_pain Fluffy_Pillow 159725.4/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:46.482 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:47.829 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:49.177 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
0:50.526 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
0:54.064 mind_blast Fluffy_Pillow 159064.3/160000: 99% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
0:55.412 devouring_plague Fluffy_Pillow 159927.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:56.761 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:00.347 mind_blast Fluffy_Pillow 159095.0/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:01.697 mind_spike Fluffy_Pillow 159559.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:03.045 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:04.393 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:05.740 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:07.090 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:08.438 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:09.785 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:11.134 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:12.482 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:13.830 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:15.178 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:16.526 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:17.877 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:19.225 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:20.574 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:21.923 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:23.272 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:27.559 mind_blast Fluffy_Pillow 159543.7/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:28.908 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:30.255 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:33.859 mind_blast Fluffy_Pillow 159106.6/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:35.207 halo Fluffy_Pillow 159569.3/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:36.557 mind_spike Fluffy_Pillow 158833.3/160000: 99% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:37.905 mind_spike Fluffy_Pillow 159505.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:39.254 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:40.601 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:41.949 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:43.297 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:44.645 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:45.994 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:47.343 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:48.691 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:50.041 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:51.388 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:52.734 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:54.083 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:55.432 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:56.780 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:01.067 mind_blast Fluffy_Pillow 159543.7/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:02.414 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:03.761 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:07.421 mind_blast Fluffy_Pillow 159142.4/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:08.769 mind_spike Fluffy_Pillow 159605.1/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:10.120 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:11.469 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:12.817 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:14.166 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:15.516 halo Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:16.866 mind_spike Fluffy_Pillow 159264.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:18.215 mind_blast Fluffy_Pillow 159936.4/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:19.562 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:20.908 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:22.256 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:23.604 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:24.952 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:26.300 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:27.649 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:28.998 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:30.348 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:34.767 mind_blast Fluffy_Pillow 159628.2/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:36.116 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:37.467 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:41.055 mind_blast Fluffy_Pillow 159096.3/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:42.404 mind_spike Fluffy_Pillow 159559.7/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:43.751 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:45.098 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:46.448 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:47.796 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:49.144 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:50.494 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:51.843 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:53.192 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:54.538 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:55.886 halo Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:57.236 mind_blast Fluffy_Pillow 159264.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:58.585 shadow_word_pain Fluffy_Pillow 159727.4/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:59.934 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:01.282 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:02.632 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:03.980 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:08.254 mind_blast Fluffy_Pillow 159535.4/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:09.603 devouring_plague Fluffy_Pillow 159998.7/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:10.951 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:14.460 mind_blast Fluffy_Pillow 159045.8/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:15.807 shadowfiend Fluffy_Pillow 159507.8/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:17.155 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:18.506 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadowy_insight, glyph_of_mind_flay
3:19.855 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:21.203 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:22.550 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:23.900 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:25.247 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:26.595 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:27.942 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:29.290 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:30.639 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:31.987 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:33.334 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:34.683 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:36.032 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:37.380 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:41.660 mind_blast Fluffy_Pillow 159539.2/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:43.009 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:44.358 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:47.863 mind_blast Fluffy_Pillow 159043.2/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:49.211 halo Fluffy_Pillow 159505.9/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:50.559 mind_spike Fluffy_Pillow 158768.6/160000: 99% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:51.907 mind_spike Fluffy_Pillow 159440.4/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:53.255 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:54.603 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:55.951 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:57.299 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:58.648 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
3:59.996 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:01.345 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:02.695 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:04.305 mind_blast Fluffy_Pillow 159430.4/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:05.654 mind_spike Fluffy_Pillow 159893.8/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:07.003 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
4:08.351 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
4:09.701 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
4:11.050 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
4:12.399 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:13.746 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:15.096 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:16.443 potion Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:16.443 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:17.792 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:21.440 mind_blast Fluffy_Pillow 159134.7/160000: 99% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:22.791 shadow_word_death Fluffy_Pillow 159599.4/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay, draenic_intellect_potion
4:24.139 shadow_word_death Fluffy_Pillow 159662.1/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:25.487 devouring_plague Fluffy_Pillow 159724.8/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:26.836 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:28.185 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:30.389 insanity Fluffy_Pillow 159810.6/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:31.880 devouring_plague Fluffy_Pillow 159164.8/160000: 99% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay, draenic_intellect_potion
4:33.230 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:34.579 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:35.927 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:37.276 halo Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:38.625 mind_blast Fluffy_Pillow 159263.4/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:39.973 mind_spike Fluffy_Pillow 159726.1/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:41.322 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:42.668 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:44.016 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
4:45.365 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
4:46.713 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:48.064 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:49.412 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:50.759 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:52.106 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:55.695 mind_blast Fluffy_Pillow 159097.0/160000: 99% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
4:57.046 shadow_word_death Fluffy_Pillow 159561.6/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 880 839 839
Agility 1124 1071 1071
Stamina 4074 3704 3704
Intellect 3870 3423 3313 (2219)
Spirit 782 782 782
Health 244440 222240 0
Mana 160000 160000 0
Shadow Orb 5 5 0
Spell Power 5309 4379 956
Crit 21.69% 16.69% 1286
Haste 11.59% 6.27% 522
Multistrike 11.33% 6.33% 418
Damage / Heal Versatility 5.18% 2.18% 284
ManaReg per Second 640 640 0
Mastery 50.00% 35.23% 670
Armor 1184 592 592
Run Speed 0 0 154

Talents

Level
15 Desperate Prayer Spectral Guise Angelic Bulwark
30 Body and Soul Angelic Feather Phantasm
45 Surge of Darkness (Shadow Priest) Mindbender Insanity (Shadow Priest)
60 Void Tendrils Psychic Scream Dominate Mind
75 Twist of Fate Power Infusion Shadowy Insight (Shadow Priest)
90 Cascade (Shadow Priest) Divine Star (Shadow Priest) Halo (Shadow Priest)
100 Clarity of Power (Shadow Priest) Void Entropy (Shadow Priest) Auspicious Spirits (Shadow Priest)

Profile

priest="Swæty"
origin="http://eu.battle.net/wow/en/character/forscherliga/Swæty/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/13/55890701-avatar.jpg"
level=100
race=night_elf
role=spell
position=back
professions=enchanting=679/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Xb!2022220
glyphs=fade/mind_blast/mind_flay/dark_archangel/heavens/shadow_ravens
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/shadowform,if=!buff.shadowform.up
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/mind_spike

# Executed every time the actor is available.

actions=shadowform,if=!buff.shadowform.up
actions+=/potion,name=draenic_intellect,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/call_action_list,name=pvp_dispersion,if=set_bonus.pvp_2pc
actions+=/call_action_list,name=decision

actions.decision=call_action_list,name=cop_dotweave,if=talent.clarity_of_power.enabled&talent.insanity.enabled&target.health.pct>20&active_enemies<=5
actions.decision+=/call_action_list,name=cop_mfi,if=talent.clarity_of_power.enabled&talent.insanity.enabled&target.health.pct<=20
actions.decision+=/call_action_list,name=cop,if=talent.clarity_of_power.enabled
actions.decision+=/call_action_list,name=vent,if=talent.void_entropy.enabled
actions.decision+=/call_action_list,name=main

actions.pvp_dispersion=call_action_list,name=decision,if=cooldown.dispersion.remains>0
actions.pvp_dispersion+=/dispersion,interrupt=1
actions.pvp_dispersion+=/call_action_list,name=decision

actions.main=mindbender,if=talent.mindbender.enabled
actions.main+=/shadowfiend,if=!talent.mindbender.enabled
actions.main+=/shadow_word_death,if=target.health.pct<20&shadow_orb<=4,cycle_targets=1
actions.main+=/mind_blast,if=glyph.mind_harvest.enabled&shadow_orb<=2&active_enemies<=5&cooldown_react
actions.main+=/devouring_plague,if=shadow_orb=5&talent.surge_of_darkness.enabled,cycle_targets=1
actions.main+=/devouring_plague,if=shadow_orb=5
actions.main+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)&!target.dot.devouring_plague_tick.ticking&talent.surge_of_darkness.enabled,cycle_targets=1
actions.main+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions.main+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
actions.main+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.main+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/insanity,chain=1,if=active_enemies<=2,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/halo,if=talent.halo.enabled&target.distance<=30&active_enemies>2
actions.main+=/cascade,if=talent.cascade.enabled&active_enemies>2&target.distance<=40
actions.main+=/divine_star,if=talent.divine_star.enabled&active_enemies>4&target.distance<=24
actions.main+=/shadow_word_pain,if=talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react,cycle_targets=1
actions.main+=/shadow_word_pain,if=!talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react&active_enemies<=5,cycle_targets=1,max_cycle_targets=5
actions.main+=/vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5,cycle_targets=1,max_cycle_targets=5
actions.main+=/devouring_plague,if=!talent.void_entropy.enabled&shadow_orb>=3&ticks_remain<=1
actions.main+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=3
actions.main+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.main+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.main+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.main+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions.main+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&cooldown.mind_blast.remains&active_enemies<=1
actions.main+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions.main+=/divine_star,if=talent.divine_star.enabled&target.distance<=28&active_enemies>1
actions.main+=/mind_sear,chain=1,if=active_enemies>=4,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/shadow_word_pain,if=shadow_orb>=2&ticks_remain<=3&talent.insanity.enabled
actions.main+=/vampiric_touch,if=shadow_orb>=2&ticks_remain<=3.5&talent.insanity.enabled
actions.main+=/mind_flay,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/mind_blast,moving=1,if=buff.shadowy_insight.react&cooldown_react
actions.main+=/divine_star,moving=1,if=talent.divine_star.enabled&target.distance<=28
actions.main+=/cascade,moving=1,if=talent.cascade.enabled&target.distance<=40
actions.main+=/shadow_word_death,moving=1
actions.main+=/shadow_word_pain,moving=1,cycle_targets=1

actions.vent=mindbender,if=talent.mindbender.enabled&cooldown.mind_blast.remains>=gcd
actions.vent+=/shadowfiend,if=!talent.mindbender.enabled&cooldown.mind_blast.remains>=gcd
actions.vent+=/void_entropy,if=shadow_orb=3&!ticking&target.time_to_die>60&active_enemies=1
actions.vent+=/void_entropy,if=!dot.void_entropy.ticking&shadow_orb=5&active_enemies>=1&target.time_to_die>60,cycle_targets=1,max_cycle_targets=(60%(cooldown.mind_blast.duration*3*spell_haste))
actions.vent+=/devouring_plague,if=dot.void_entropy.ticking&dot.void_entropy.remains<=gcd*2&cooldown_react,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains<10,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains<20,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains,cycle_targets=1
actions.vent+=/halo,if=talent.halo.enabled&target.distance<=30&active_enemies>=4
actions.vent+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
actions.vent+=/devouring_plague,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb>=3,cycle_targets=1
actions.vent+=/mind_blast,if=active_enemies<=10&cooldown_react&shadow_orb<=4
actions.vent+=/shadow_word_death,if=target.health.pct<20&cooldown_react&shadow_orb<=4,cycle_targets=1
actions.vent+=/shadow_word_pain,if=shadow_orb=4&remains<(18*0.50)&set_bonus.tier17_2pc&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
actions.vent+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=3&cooldown.mind_blast.remains>0.5*gcd,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/insanity,chain=1,if=active_enemies<=3&cooldown.mind_blast.remains>0.5*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=3
actions.vent+=/shadow_word_pain,if=remains<(18*0.35)&miss_react,cycle_targets=1,max_cycle_targets=5
actions.vent+=/vampiric_touch,if=remains<(15*0.35)&miss_react,cycle_targets=1,max_cycle_targets=5
actions.vent+=/halo,if=talent.halo.enabled&target.distance<=30&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/cascade,if=talent.cascade.enabled&target.distance<=40&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/divine_star,if=talent.divine_star.enabled&active_enemies>4&target.distance<=24&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.up&cooldown_react&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/mind_sear,chain=1,if=active_enemies>=3&cooldown.mind_blast.remains>0.5*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/mind_flay,if=cooldown.mind_blast.remains>0.5*gcd,interrupt=1,chain=1
actions.vent+=/shadow_word_death,moving=1
actions.vent+=/mind_blast,moving=1,if=buff.shadowy_insight.react&cooldown_react
actions.vent+=/divine_star,moving=1,if=talent.divine_star.enabled&target.distance<=28
actions.vent+=/cascade,moving=1,if=talent.cascade.enabled&target.distance<=40
actions.vent+=/shadow_word_death,moving=1
actions.vent+=/shadow_word_pain,moving=1,cycle_targets=1

actions.cop_dotweave=devouring_plague,if=target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&shadow_orb=5&cooldown_react
actions.cop_dotweave+=/devouring_plague,if=(buff.mental_instinct.remains<gcd&buff.mental_instinct.remains)
actions.cop_dotweave+=/devouring_plague,if=(target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&!buff.shadow_word_insanity.remains&cooldown.mind_blast.remains>0.4*gcd)
actions.cop_dotweave+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
actions.cop_dotweave+=/mind_blast,if=shadow_orb<=4&cooldown_react
actions.cop_dotweave+=/shadowfiend,if=!talent.mindbender.enabled&!buff.shadow_word_insanity.remains
actions.cop_dotweave+=/mindbender,if=talent.mindbender.enabled&!buff.shadow_word_insanity.remains
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb=4&set_bonus.tier17_2pc&!target.dot.shadow_word_pain.ticking&!target.dot.devouring_plague.ticking&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.shadow_word_pain.ticking
actions.cop_dotweave+=/vampiric_touch,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.vampiric_touch.ticking
actions.cop_dotweave+=/insanity,if=buff.shadow_word_insanity.remains,chain=1,interrupt_if=cooldown.mind_blast.remains<=0.1
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb>=2&target.dot.shadow_word_pain.remains>=6&cooldown.mind_blast.remains>0.5*gcd&target.dot.vampiric_touch.remains&buff.bloodlust.up&!set_bonus.tier17_2pc
actions.cop_dotweave+=/vampiric_touch,if=shadow_orb>=2&target.dot.vampiric_touch.remains>=5&cooldown.mind_blast.remains>0.5*gcd&buff.bloodlust.up&!set_bonus.tier17_2pc
actions.cop_dotweave+=/halo,if=cooldown.mind_blast.remains>0.5*gcd&talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop_dotweave+=/divine_star,if=cooldown.mind_blast.remains>0.5&gcd&talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop_dotweave+=/cascade,if=cooldown.mind_blast.remains>0.5*gcd&talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop_dotweave+=/shadow_word_pain,if=primary_target=0&(!ticking|remains<=18*0.3),cycle_targets=1,max_cycle_targets=5
actions.cop_dotweave+=/vampiric_touch,if=primary_target=0&(!ticking|remains<=15*0.3),cycle_targets=1,max_cycle_targets=5
actions.cop_dotweave+=/mind_spike,if=buff.shadow_word_insanity.remains<=gcd&buff.bloodlust.up&!target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains
actions.cop_dotweave+=/mind_spike,if=((target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains)|(!target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains))&shadow_orb<=2&cooldown.mind_blast.remains>0.5*gcd
actions.cop_dotweave+=/mind_flay,if=set_bonus.tier17_2pc&target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains&cooldown.mind_blast.remains>0.9*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop_dotweave+=/mind_spike
actions.cop_dotweave+=/shadow_word_death,moving=1
actions.cop_dotweave+=/halo,if=talent.halo.enabled&target.distance<=30,moving=1
actions.cop_dotweave+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop_dotweave+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop_dotweave+=/shadow_word_pain,moving=1

actions.cop_mfi=devouring_plague,if=shadow_orb=5
actions.cop_mfi+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
actions.cop_mfi+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.cop_mfi+=/shadow_word_death,if=target.health.pct<20,cycle_targets=1
actions.cop_mfi+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<gcd*1.0|target.health.pct<20&cooldown.shadow_word_death.remains<gcd*1.0)
actions.cop_mfi+=/mindbender,if=talent.mindbender.enabled
actions.cop_mfi+=/shadowfiend,if=!talent.mindbender.enabled
actions.cop_mfi+=/shadow_word_pain,if=remains<(18*0.3)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop_mfi+=/vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop_mfi+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
actions.cop_mfi+=/insanity,if=active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
actions.cop_mfi+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop_mfi+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop_mfi+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop_mfi+=/mind_sear,if=active_enemies>=6,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop_mfi+=/mind_spike
actions.cop_mfi+=/shadow_word_death,moving=1
actions.cop_mfi+=/mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
actions.cop_mfi+=/halo,if=talent.halo.enabled&target.distance<=30,moving=1
actions.cop_mfi+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop_mfi+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop_mfi+=/shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

actions.cop=devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<=gcd*1.0|(cooldown.shadow_word_death.remains<=gcd*1.0&target.health.pct<20))&primary_target=0,cycle_targets=1
actions.cop+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<=gcd*1.0|(cooldown.shadow_word_death.remains<=gcd*1.0&target.health.pct<20))
actions.cop+=/mind_blast,if=mind_harvest=0,cycle_targets=1
actions.cop+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.cop+=/shadow_word_death,if=target.health.pct<20,cycle_targets=1
actions.cop+=/mindbender,if=talent.mindbender.enabled
actions.cop+=/shadowfiend,if=!talent.mindbender.enabled
actions.cop+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop+=/shadow_word_pain,if=miss_react&!ticking&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop+=/vampiric_touch,if=remains<cast_time&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop+=/mind_sear,if=active_enemies>=5,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_spike,if=active_enemies<=4&buff.surge_of_darkness.react
actions.cop+=/mind_sear,if=active_enemies>=3,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_flay,if=target.dot.devouring_plague_tick.ticks_remain>1&active_enemies=1,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_spike
actions.cop+=/shadow_word_death,moving=1
actions.cop+=/mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
actions.cop+=/halo,moving=1,if=talent.halo.enabled&target.distance<=30
actions.cop+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop+=/shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

head=crown_of_power,id=118942
neck=braided_magnaron_plait,id=120084,enchant=40crit
shoulders=felflame_spaulders,id=109948,bonus_id=523/524,gems=35mastery
back=kyusys_tarflame_doomcloak,id=119346,bonus_id=560,enchant=100crit
chest=robes_of_volatile_ice,id=114500,bonus_id=81/563,gems=35crit
shirt=paper_shirt,id=98087
tabard=argent_crusaders_tabard,id=46874
wrists=bracers_of_volatile_ice,id=114493,bonus_id=220/560
hands=gloves_of_arcane_mystery,id=109844,bonus_id=499/523/524,gems=35crit
waist=cord_of_arcane_mystery,id=109824,bonus_id=42/524
legs=lightbinder_leggings,id=109807,bonus_id=523/524,gems=35mastery
feet=sandals_of_volatile_ice,id=114501,bonus_id=142/563,gems=35crit
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=30crit
finger2=darkflame_loop,id=109766,bonus_id=524,enchant=30crit
trinket1=grandiose_power,id=114550,bonus_id=42
trinket2=crushtos_runic_alarm,id=110000,bonus_id=524
main_hand=hoof_of_yalnu,id=119181,bonus_id=524,enchant=mark_of_the_shattered_hand
off_hand=bileslingers_censer,id=113592,bonus_id=566

# Gear Summary
# gear_stamina=2814
# gear_intellect=2219
# gear_spell_power=956
# gear_crit_rating=1286
# gear_haste_rating=497
# gear_mastery_rating=670
# gear_armor=592
# gear_multistrike_rating=418
# gear_versatility_rating=284
# gear_speed_rating=154

Ralana

Ralana : 19673 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
19673.1 19673.1 7.1 / 0.036% 2213.4 / 11.3% 686.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.6 28.6 Energy 32.73% 43.0 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ralana/advanced
Talents
  • 15: Shadow Focus
  • 30: Combat Readiness
  • 45: Elusiveness
  • 60: Shadowstep
  • 75: Prey on the Weak
  • 90: Anticipation
  • 100: Venom Rush
  • Talent Calculator
Glyphs
  • Glyph of Energy
  • Glyph of Feint
  • Glyph of Disappearance
  • Glyph of Poisons
  • Glyph of Safe Fall
  • Glyph of Decoy
Professions
  • engineering: 659
  • jewelcrafting: 657

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Ralana+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:27784|18809|17720|9445|7105|4289|2019&chds=0,55568&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++27784++eviscerate,C79C6E,0,0,15|t++18809++killing_spree,C79C6E,1,0,15|t++17720++ambush,C79C6E,2,0,15|t++9445++sinister_strike,C79C6E,3,0,15|t++7105++revealing_strike,C79C6E,4,0,15|t++4289++auto_attack_mh,C79C6E,5,0,15|t++2019++auto_attack_oh,C79C6E,6,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ralana+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:21,19,16,14,10,10,4,2,2,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E&chl=auto_attack_mh|sinister_strike|eviscerate|main_gauche|auto_attack_oh|instant_poison|killing_spree_mh|ambush|killing_spree_oh|revealing_strike&
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Ralana+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:begjnqtx2668765545665431ywvrolkjhfecbZXWVVVVWXXYYZabcefghijkklllkkjihgfdcbaZZYYYZZabcdfhjlnprsuwxy0111100zxwuspnlkigecaZXWVVUUUUUVVWWXYZaabccddddeeeedddccbaaZYYYYXXXYYYZaabcdeghiijklmmnnnnnmmlkjihgfedcbaZYYXXWWWWWXXXXYYZaabcddefgghhhhiihhhgffedcbbaZYYXXXWWXXXYZaabcdfghijklmnnnooooonnmlkjihgfedcbaaZYYYYXXYYYYYZZZZaaaabbbbbbbbbbaaaaaaaaaaaaaaabbccddeffgghhiiiihhgedbZXWUSQOM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.550753,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=19673|max=35720&chxp=1,1,55,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Ralana+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,4,13,14,34,43,81,114,174,246,363,515,594,812,898,1085,1192,1293,1393,1522,1498,1480,1491,1378,1283,1193,1118,961,772,699,606,490,402,325,271,185,154,85,68,45,26,24,17,14,4,7,5,3,1,1&chds=0,1522&chbh=5&chxt=x&chxl=0:|min=17789|avg=19673|max=22137&chxp=0,1,43,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ralana+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:40.3,11.0,6.1,4.0,3.2,2.4,0.4,32.7&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=sinister_strike 121.1s|eviscerate 33.1s|killing_spree 18.4s|revealing_strike 12.2s|slice_and_dice 9.5s|ambush 7.2s|preparation 1.2s|waiting 98.5s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ralana 19673
ambush 422 2.1% 7.1 48.55sec 17797 17720 Direct 7.1 14111 28202 16904 19.8% 1.3 4235 8444 20.3%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.12 7.12 0.00 0.00 1.0045 0.0000 126783.29 194845.89 34.93 17719.54 17719.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.25 20.28% 8444.47 6401 11857 1908.72 0 11857 2140 3290 7.89
multistrike 1.00 79.72% 4235.47 3201 5928 2714.91 0 5928 4221 6488 22.36
hit 5.71 80.18% 14111.07 10669 19761 14136.10 0 17882 80596 123864 34.93
crit 1.41 19.82% 28202.09 21338 39522 22203.38 0 39522 39825 61205 27.47
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
auto_attack_mh 4228 21.5% 212.4 1.42sec 5981 4289 Direct 212.4 4737 9475 5680 19.9% 37.5 1421 2843 19.9%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 212.40 212.40 0.00 0.00 1.3945 0.0000 1270253.33 1952178.81 34.93 4288.69 4288.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.48 19.94% 2843.09 2201 4088 2841.40 0 4088 21267 32684 34.90
multistrike 30.03 80.06% 1421.08 1101 2044 1422.11 1233 1665 42672 65580 34.93
hit 170.14 80.11% 4736.97 3669 6813 4740.11 4574 4941 805967 1238644 34.93
crit 42.25 19.89% 9474.94 7337 13626 9480.77 8468 10530 400347 615271 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 1987 10.1% 209.0 1.44sec 2857 2019 Direct 209.0 2263 4527 2713 19.9% 36.8 679 1358 19.9%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 209.02 209.02 0.00 0.00 1.4152 0.0000 597111.77 917666.51 34.93 2018.59 2018.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.32 19.87% 1358.44 1051 1970 1358.38 0 1970 9945 15285 34.90
multistrike 29.52 80.13% 678.99 526 985 679.41 578 794 20046 30808 34.93
hit 167.49 80.13% 2263.46 1752 3283 2264.99 2186 2353 379100 582616 34.93
crit 41.53 19.87% 4527.21 3503 6565 4530.28 4047 5166 188021 288958 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
eviscerate 3065 15.6% 35.4 8.11sec 25997 27784 Direct 35.4 20593 41187 24691 19.9% 6.2 6182 12357 20.1%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.41 35.41 0.00 0.00 0.9357 0.0000 920675.37 1414932.68 34.93 27783.91 27783.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.25 20.05% 12356.86 8468 16328 8795.07 0 16328 15443 23734 24.84
multistrike 4.98 79.95% 6182.28 4234 8164 6137.20 0 8164 30803 47339 34.63
hit 28.37 80.10% 20592.75 14113 27214 20616.76 18885 22522 584149 897744 34.93
crit 7.05 19.90% 41186.60 28227 54428 41218.26 0 54428 290281 446116 34.91
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.507760
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
instant_poison 1896 9.6% 205.3 1.49sec 2774 0 Direct 205.3 2196 4394 2634 19.9% 36.3 659 1318 20.0%  

Stats details: instant_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 205.26 205.26 0.00 0.00 0.0000 0.0000 569336.17 569336.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.24 19.95% 1317.60 1003 1934 1317.21 0 1934 9534 9534 0.00
multistrike 29.03 80.05% 658.86 502 967 659.36 562 797 19130 19130 0.00
hit 164.37 80.08% 2196.34 1672 3223 2198.04 2066 2354 361007 361007 0.00
crit 40.89 19.92% 4394.08 3344 6446 4397.46 3915 5066 179664 179664 0.00
 
DPS Timeline Chart
 

Action details: instant_poison

Static Values
  • id:157607
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157607
  • name:Instant Poison
  • school:nature
  • tooltip:
  • description:{$@spelldesc157584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of instantly poisoning the enemy for {$157607s1=0 to 2} Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.264000
  • spell_power_mod.direct:0.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
killing_spree 0 (1156) 0.0% (5.9%) 5.7 57.50sec 60836 18809

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.70 5.70 39.69 39.69 3.2346 0.4282 0.00 0.00 0.00 18808.63 18808.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.8 80.13% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.9 19.87% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time_to_die>=44
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    killing_spree_mh 782 4.0% 39.7 7.05sec 5909 0 Periodic 39.7 4560 9122 5465 19.8% 7.0 2102 4201 19.9% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.69 0.00 0.00 39.69 0.0000 0.0000 234523.16 350949.66 33.17 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.4 19.92% 4200.74 3166 5864 3162.28 0 5864 5859 5859 0.00
multistrike 5.6 80.08% 2102.21 1583 2932 2095.23 0 2932 11791 11791 0.00
hit 31.8 80.17% 4559.90 3433 6359 4562.53 3902 5340 145071 222952 34.93
crit 7.9 19.83% 9121.58 6867 12718 9127.03 0 12718 71802 110348 34.92
 
DPS Timeline Chart
 

Action details: killing_spree_mh

Static Values
  • id:57841
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57841
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    killing_spree_oh 374 1.9% 39.7 7.05sec 2823 0 Periodic 39.7 2177 4357 2610 19.9% 7.0 1004 2011 19.9% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.69 0.00 0.00 39.69 0.0000 0.0000 112025.79 167635.56 33.17 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.4 19.87% 2010.95 1507 2818 1509.06 0 2818 2801 2801 0.00
multistrike 5.6 80.13% 1003.66 753 1409 999.85 0 1409 5638 5638 0.00
hit 31.8 80.13% 2177.21 1634 3056 2178.42 1847 2532 69241 106412 34.93
crit 7.9 19.87% 4356.56 3268 6111 4358.53 0 6111 34346 52785 34.93
 
DPS Timeline Chart
 

Action details: killing_spree_oh

Static Values
  • id:57842
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57842
  • name:Killing Spree Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
main_gauche 2823 14.3% 220.7 1.43sec 3841 0 Direct 220.7 3042 6084 3648 19.9% 38.9 913 1826 19.9%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 220.68 220.68 0.00 0.00 0.0000 0.0000 847576.63 1302591.45 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.74 19.90% 1825.74 1373 2567 1826.31 0 2567 14140 21731 34.91
multistrike 31.16 80.10% 912.63 686 1283 913.16 780 1101 28442 43710 34.93
hit 176.71 80.08% 3041.81 2288 4278 3043.60 2869 3245 537521 826085 34.93
crit 43.97 19.92% 6083.52 4575 8556 6087.26 5388 6966 267474 411066 34.93
 
DPS Timeline Chart
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.40
 
revealing_strike 288 1.5% 12.7 24.26sec 6810 7105 Direct 12.7 5389 10786 6467 20.0% 2.2 1617 3233 19.9%  

Stats details: revealing_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.69 12.69 96.46 96.46 0.9585 3.0000 86422.67 1096044.77 92.12 286.60 7104.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.45 19.92% 3233.43 2472 4579 1172.21 0 4579 1447 2224 12.67
multistrike 1.80 80.08% 1616.76 1236 2289 1355.98 0 2289 2909 4470 29.28
hit 10.16 80.03% 5388.72 4120 7631 5391.66 4418 6543 54727 84106 34.93
crit 2.53 19.97% 10786.41 8240 15262 10118.80 0 15262 27340 42018 32.76
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.3 80.16% 0.00 0 0 0.00 0 0 0 772053 100.00
crit 19.1 19.84% 0.00 0 0 0.00 0 0 0 191174 100.00
 
DPS Timeline Chart
 

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
Spelldata
  • id:84617
  • name:Revealing Strike
  • school:physical
  • tooltip:Reveals weakness, increasing the effectiveness of the Rogue's offensive finishing moves by $w3%, and giving the Rogue's Sinister Strikes a {$h=0}% chance to generate an extra combo point.
  • description:Deals $sw1 Physical damage, increasing the effect of your offensive finishing moves on that target by {$s3=35}%, and giving your Sinister Strike a {$s6=25}% chance to generate an extra combo point. Lasts {$d=24 seconds}. Awards {$s2=1} combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
sinister_strike 3810 19.4% 128.7 2.30sec 8890 9445 Direct 128.7 7043 14086 8443 19.9% 22.7 2112 4227 19.9%  

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.72 128.72 0.00 0.00 0.9412 0.0000 1144260.09 1758547.08 34.93 9445.30 9445.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.51 19.88% 4226.64 3296 6105 4171.67 0 6105 19063 29297 34.45
multistrike 18.17 80.12% 2112.41 1648 3052 2113.88 1725 2625 38387 58995 34.93
hit 103.12 80.11% 7042.60 5493 10175 7047.55 6756 7410 726208 1116067 34.93
crit 25.60 19.89% 14086.19 10986 20349 14095.41 12108 16557 360602 554189 34.93
 
DPS Timeline Chart
 

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.revealing_strike.ticking
Spelldata
  • id:1752
  • name:Sinister Strike
  • school:physical
  • tooltip:
  • description:An instant strike that causes $sw3 Physical damage.{$?s79327=false}[ Awards {$s2=0} combo $lpoint:points;.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.60
 
Simple Action Stats Execute Interval
Ralana
adrenaline_rush 3.9 86.90sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.86 3.86 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 3.86 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time_to_die>=44
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by ${$m3/-1000}.1 sec.][]
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}. While Adrenaline Rush is active, the global cooldown on most of your Energy consumers is reduced by ${$m3/-1000}.1 sec
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
preparation 1.2 312.51sec

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.23 1.23 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.23 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.vanish.up&cooldown.vanish.remains>30
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:
  • description:Immediately resets the cooldown on your Sprint, Vanish, and Evasion.
 
slice_and_dice 9.8 32.13sec

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.80 9.80 0.00 0.00 0.9679 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 9.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.marked_for_death.enabled
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
 
vanish 6.1 48.55sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.12 6.12 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 6.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for {$11327d=3 seconds}. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
adrenaline_rush 3.9 0.0 86.9sec 86.9sec 18.77% 18.25% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:18.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by ${$m3/-1000}.1 sec.][]
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}. While Adrenaline Rush is active, the global cooldown on most of your Energy consumers is reduced by ${$m3/-1000}.1 sec
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
anticipation 23.5 55.0 12.5sec 3.7sec 46.68% 46.68% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_anticipation
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • anticipation_1:14.36%
  • anticipation_2:12.05%
  • anticipation_3:10.18%
  • anticipation_4:7.19%
  • anticipation_5:2.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115189
  • name:Anticipation
  • tooltip:Your next offensive finishing move will grant you {$s1=1} combo points on that target.
  • description:{$@spelldesc114015=When one of your attacks generates a combo point while you already have 5 combo points, you gain an Anticipation charge. Performing an offensive finishing move consumes all Anticipation charges and grants you a combo point for each.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
bandits_guile 7.7 81.3 40.5sec 3.3sec 94.91% 94.91% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_bandits_guile
  • max_stacks:12
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bandits_guile_1:5.56%
  • bandits_guile_2:5.64%
  • bandits_guile_3:5.74%
  • bandits_guile_4:5.63%
  • bandits_guile_5:5.58%
  • bandits_guile_6:5.51%
  • bandits_guile_7:5.43%
  • bandits_guile_8:5.47%
  • bandits_guile_9:5.46%
  • bandits_guile_10:5.26%
  • bandits_guile_11:4.96%
  • bandits_guile_12:34.66%

Trigger Attempt Success

  • trigger_pct:69.17%

Spelldata details

  • id:84654
  • name:Bandit's Guile
  • tooltip:
  • description:Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 21.79% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
deep_insight 7.1 0.0 42.9sec 42.9sec 34.66% 10.59% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_deep_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • deep_insight_1:34.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84747
  • name:Deep Insight
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
draenic_agility_potion 2.0 0.0 87.0sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
exquisite_proficiency 4.9 0.0 68.2sec 68.3sec 31.40% 31.41% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_exquisite_proficiency
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:581.00

Stack Uptimes

  • exquisite_proficiency_1:31.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:133630
  • name:Exquisite Proficiency
  • tooltip:Increases Mastery rating by {$s1=609}.
  • description:Increases Mastery rating by {$s1=609} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
killing_spree 2.2 0.0 169.0sec 169.0sec 2.19% 2.19% 13.1(13.1)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:3.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • killing_spree_1:2.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51690
  • name:Killing Spree
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.
  • max_stacks:0
  • duration:3.00
  • cooldown:120.00
  • default_chance:0.00%
mark_of_warsong 5.0 2.2 63.3sec 40.9sec 39.08% 39.09% 2.2(12.8)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_mark_of_warsong
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:haste_rating
  • amount:100.00

Stack Uptimes

  • mark_of_warsong_1:3.17%
  • mark_of_warsong_2:3.32%
  • mark_of_warsong_3:3.47%
  • mark_of_warsong_4:3.63%
  • mark_of_warsong_5:3.79%
  • mark_of_warsong_6:3.96%
  • mark_of_warsong_7:4.14%
  • mark_of_warsong_8:4.33%
  • mark_of_warsong_9:4.53%
  • mark_of_warsong_10:4.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159675
  • name:Mark of Warsong
  • tooltip:Haste increased by $w1.
  • description:Haste increased by {$s1=100}.
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
moderate_insight 7.3 21.7 42.0sec 9.7sec 21.16% 37.75% 21.7(21.7)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_moderate_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • moderate_insight_1:21.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84746
  • name:Moderate Insight
  • tooltip:Damage dealt increased by $s2%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
shallow_insight 7.6 22.3 41.0sec 9.6sec 22.15% 39.18% 22.3(22.3)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_shallow_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • shallow_insight_1:22.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84745
  • name:Shallow Insight
  • tooltip:Damage dealt increased by {$s1=10}%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 1.1 8.7 245.5sec 32.1sec 99.63% 100.00% 8.7(8.7)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • slice_and_dice_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealth 6.1 0.0 52.4sec 59.9sec 0.00% 0.02% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:0.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}%. ]?s13975[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%. ][]{$?s31223=false}[Attacks from Stealth and for {$31666d=6 seconds} after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:6.00
  • default_chance:100.00%
turbulent_vial_of_toxin 3.8 0.0 90.4sec 90.5sec 18.32% 18.33% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_turbulent_vial_of_toxin
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:1120.00

Stack Uptimes

  • turbulent_vial_of_toxin_1:18.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:176883
  • name:Turbulent Vial of Toxin
  • tooltip:Mastery increased by {$s1=870}.
  • description:Grants {$s1=870} Mastery for {$d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
vanish 6.1 0.0 48.5sec 48.5sec 0.00% 0.02% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ralana
ambush Energy 7.1 202.7 28.5 28.5 625.5
eviscerate Energy 35.4 1239.5 35.0 35.0 742.8
eviscerate Combo Points 35.4 177.1 5.0 5.0 5199.4
revealing_strike Energy 12.7 507.6 40.0 40.0 170.3
sinister_strike Energy 128.7 6435.8 50.0 50.0 177.8
slice_and_dice Energy 9.8 245.1 25.0 25.0 0.0
slice_and_dice Combo Points 9.8 43.7 4.5 4.5 0.0
Resource Gains Type Count Total Average Overflow
ambush Combo Points 8.21 14.25 (6.16%) 1.74 0.00 0.00%
revealing_strike Combo Points 12.55 12.55 (5.42%) 1.00 0.00 0.00%
sinister_strike Combo Points 160.41 160.41 (69.33%) 1.00 0.00 0.00%
energy_regen Energy 1076.18 4545.10 (53.49%) 4.22 159.61 3.39%
adrenaline_rush Energy 179.14 902.70 (10.62%) 5.04 17.42 1.89%
combat_potency Energy 136.53 1944.57 (22.89%) 14.24 103.41 5.05%
ruthlessness Energy 44.16 1104.09 (12.99%) 25.00 0.00 0.00%
ruthlessness Combo Points 44.16 44.16 (19.09%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.24 28.59
Combo Points 0.75 0.73
Combat End Resource Mean Min Max
Energy 28.56 0.00 135.00
Combo Points 3.98 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.5%
shadow_reflection-Energy Cap 1.5%

Procs

Count Interval
Anticipation Charges (wasted) 5.9 46.7sec

Statistics & Data Analysis

Fight Length
Sample Data Ralana Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Ralana Damage Per Second
Count 25000
Mean 19673.08
Minimum 17788.64
Maximum 22136.94
Spread ( max - min ) 4348.30
Range [ ( max - min ) / 2 * 100% ] 11.05%
Standard Deviation 571.5700
5th Percentile 18777.48
95th Percentile 20652.96
( 95th Percentile - 5th Percentile ) 1875.47
Mean Distribution
Standard Deviation 3.6149
95.00% Confidence Intervall ( 19666.00 - 19680.17 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3242
0.1 Scale Factor Error with Delta=300 2788
0.05 Scale Factor Error with Delta=300 11155
0.01 Scale Factor Error with Delta=300 278883
Distribution Chart
DPS(e)
Sample Data Ralana Damage Per Second (Effective)
Count 25000
Mean 19673.08
Minimum 17788.64
Maximum 22136.94
Spread ( max - min ) 4348.30
Range [ ( max - min ) / 2 * 100% ] 11.05%
Damage
Sample Data Ralana Damage
Count 25000
Mean 5908968.27
Minimum 4350062.77
Maximum 7608613.00
Spread ( max - min ) 3258550.23
Range [ ( max - min ) / 2 * 100% ] 27.57%
DTPS
Sample Data Ralana Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ralana Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ralana Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ralana Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ralana Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ralana Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RalanaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ralana Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=frosty_stew
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_agility
5 0.00 stealth
6 0.00 marked_for_death
7 0.00 slice_and_dice,if=talent.marked_for_death.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|(buff.adrenaline_rush.up&(trinket.proc.any.react|trinket.stacking_proc.any.react|buff.archmages_greater_incandescence_agi.react))
9 0.00 kick
A 1.23 preparation,if=!buff.vanish.up&cooldown.vanish.remains>30
B 3.77 use_item,slot=trinket1
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent,if=energy<60
F 0.00 blade_flurry,if=(active_enemies>=2&!buff.blade_flurry.up)|(active_enemies<2&buff.blade_flurry.up)
G 0.00 shadow_reflection,if=(cooldown.killing_spree.remains<10&combo_points>3)|buff.adrenaline_rush.up
H 7.12 ambush
I 6.12 vanish,if=time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
J 9.80 slice_and_dice,if=buff.slice_and_dice.remains<2|((target.time_to_die>45&combo_points=5&buff.slice_and_dice.remains<12)&buff.deep_insight.down)
K 0.00 call_action_list,name=adrenaline_rush,if=(energy<35|buff.bloodlust.up)&cooldown.killing_spree.remains>10
L 0.00 call_action_list,name=killing_spree,if=(energy<40|(buff.bloodlust.up&time<10)|buff.bloodlust.remains>20)&buff.adrenaline_rush.down&(!talent.shadow_reflection.enabled|cooldown.shadow_reflection.remains>30|buff.shadow_reflection.remains>3)
M 0.00 marked_for_death,if=combo_points<=1&dot.revealing_strike.ticking&(!talent.shadow_reflection.enabled|buff.shadow_reflection.up|cooldown.shadow_reflection.remains>30)
N 0.00 call_action_list,name=generator,if=combo_points<5|!dot.revealing_strike.ticking|(talent.anticipation.enabled&anticipation_charges<=4&buff.deep_insight.down)
O 0.00 call_action_list,name=finisher,if=combo_points=5&dot.revealing_strike.ticking&(buff.deep_insight.up|!talent.anticipation.enabled|(talent.anticipation.enabled&anticipation_charges>=4))
actions.adrenaline_rush
# count action,conditions
P 3.81 adrenaline_rush,if=time_to_die>=44
Q 0.03 adrenaline_rush,if=time_to_die<44&(buff.archmages_greater_incandescence_agi.react|trinket.proc.any.react|trinket.stacking_proc.any.react)
R 0.02 adrenaline_rush,if=time_to_die<=buff.adrenaline_rush.duration*1.5
actions.killing_spree
# count action,conditions
S 5.63 killing_spree,if=time_to_die>=44
T 0.00 killing_spree,if=time_to_die<44&buff.archmages_greater_incandescence_agi.react&buff.archmages_greater_incandescence_agi.remains>=buff.killing_spree.duration
U 0.04 killing_spree,if=time_to_die<44&trinket.proc.any.react&trinket.proc.any.remains>=buff.killing_spree.duration
V 0.00 killing_spree,if=time_to_die<44&trinket.stacking_proc.any.react&trinket.stacking_proc.any.remains>=buff.killing_spree.duration
W 0.03 killing_spree,if=time_to_die<=buff.killing_spree.duration*1.5
actions.generator Combo point generators
# count action,conditions
X 12.69 revealing_strike,if=(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
Y 128.72 sinister_strike,if=dot.revealing_strike.ticking
actions.finisher Combo point finishers
# count action,conditions
Z 0.00 death_from_above
a 35.41 eviscerate

Sample Sequence

01245BHJSPXYYYJYYYYYYYYaYaYYaYYIHAaYYIHaXYYYYYaYYJYYXYaYSYYaaYYYYaYYYXYJYYYYP8YYaBYYYaYYaaYYYXaYIHSaYYYYJYYXYYYYaYYYaYYaXaYYaYJYYIHSJYYXYPYYaYYYBYaYaYYaYYYaYXYYJYYYYYYaXIHYSYaYYaYYaYXaYYJYYPYYYYYaYYYaYYaXaBYSYYJYYYIHYYaXYY

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre food Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre apply_poison Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre potion Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
Pre stealth Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
0:00.000 use_item_turbulent_vial_of_toxin Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
0:00.000 ambush Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion, turbulent_vial_of_toxin
0:01.003 slice_and_dice Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points bloodlust, mark_of_warsong(10), draenic_agility_potion, turbulent_vial_of_toxin
0:02.007 killing_spree Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, mark_of_warsong(9), draenic_agility_potion, turbulent_vial_of_toxin
0:05.281 adrenaline_rush Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), draenic_agility_potion, turbulent_vial_of_toxin
0:05.281 revealing_strike Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), draenic_agility_potion, turbulent_vial_of_toxin
0:06.085 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
0:06.889 sinister_strike Fluffy_Pillow 132.8/135: 98% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile, adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
0:07.692 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(2), adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
0:08.496 slice_and_dice Fluffy_Pillow 132.6/135: 98% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(3), adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), draenic_agility_potion, turbulent_vial_of_toxin
0:09.301 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(3), adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), draenic_agility_potion, turbulent_vial_of_toxin
0:10.105 sinister_strike Fluffy_Pillow 117.5/135: 87% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(4), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), draenic_agility_potion, turbulent_vial_of_toxin
0:10.907 sinister_strike Fluffy_Pillow 99.6/135: 74% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), draenic_agility_potion, turbulent_vial_of_toxin
0:11.711 sinister_strike Fluffy_Pillow 96.9/135: 72% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), draenic_agility_potion, turbulent_vial_of_toxin
0:12.515 sinister_strike Fluffy_Pillow 78.9/135: 58% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(4), draenic_agility_potion, turbulent_vial_of_toxin
0:13.321 sinister_strike Fluffy_Pillow 90.9/135: 67% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(4), draenic_agility_potion, turbulent_vial_of_toxin
0:14.127 sinister_strike Fluffy_Pillow 72.9/135: 54% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(3), draenic_agility_potion, turbulent_vial_of_toxin
0:14.930 sinister_strike Fluffy_Pillow 54.5/135: 40% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(3), draenic_agility_potion, turbulent_vial_of_toxin
0:15.735 eviscerate Fluffy_Pillow 81.2/135: 60% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(5), exquisite_proficiency, mark_of_warsong(3), draenic_agility_potion
0:16.538 sinister_strike Fluffy_Pillow 117.6/135: 87% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(2), draenic_agility_potion
0:17.342 eviscerate Fluffy_Pillow 114.0/135: 84% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(2), draenic_agility_potion
0:18.146 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong, draenic_agility_potion
0:18.950 sinister_strike Fluffy_Pillow 131.1/135: 97% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong, draenic_agility_potion
0:19.755 eviscerate Fluffy_Pillow 127.2/135: 94% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong, draenic_agility_potion
0:20.560 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10)
0:21.564 sinister_strike Fluffy_Pillow 106.0/135: 79% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10)
0:22.570 vanish Fluffy_Pillow 77.0/135: 57% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(9)
0:22.570 ambush Fluffy_Pillow 77.0/135: 57% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, mark_of_warsong(9)
0:23.577 preparation Fluffy_Pillow 97.9/135: 73% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong(9)
0:24.579 eviscerate Fluffy_Pillow 118.6/135: 88% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong(8)
0:25.584 sinister_strike Fluffy_Pillow 129.3/135: 96% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(8)
0:26.588 sinister_strike Fluffy_Pillow 114.8/135: 85% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7)
0:27.594 vanish Fluffy_Pillow 85.3/135: 63% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7)
0:27.594 ambush Fluffy_Pillow 85.3/135: 63% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, vanish, slice_and_dice, mark_of_warsong(7)
0:28.598 eviscerate Fluffy_Pillow 90.6/135: 67% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong(6)
0:29.602 revealing_strike Fluffy_Pillow 101.0/135: 75% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6)
0:30.608 sinister_strike Fluffy_Pillow 81.3/135: 60% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(10)
0:31.612 sinister_strike Fluffy_Pillow 52.3/135: 39% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice, mark_of_warsong(10)
0:32.617 Waiting 1.300 sec 23.3/135: 17% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile, slice_and_dice, mark_of_warsong(9)
0:33.917 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile, slice_and_dice, mark_of_warsong(10)
0:34.923 Waiting 1.465 sec 21.5/135: 16% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(2), slice_and_dice, anticipation, mark_of_warsong(10)
0:36.388 sinister_strike Fluffy_Pillow 52.0/135: 39% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(2), slice_and_dice, anticipation, mark_of_warsong(9)
0:37.392 Waiting 1.003 sec 22.9/135: 17% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(3), slice_and_dice, anticipation(3), mark_of_warsong(8)
0:38.395 sinister_strike Fluffy_Pillow 58.5/135: 43% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(3), slice_and_dice, anticipation(3), mark_of_warsong(8)
0:39.401 Waiting 0.100 sec 29.2/135: 22% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), shallow_insight, slice_and_dice, anticipation(5), mark_of_warsong(7)
0:39.501 eviscerate Fluffy_Pillow 46.3/135: 34% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), shallow_insight, slice_and_dice, anticipation(5), mark_of_warsong(7)
0:40.506 sinister_strike Fluffy_Pillow 56.8/135: 42% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), shallow_insight, slice_and_dice, mark_of_warsong(7)
0:41.511 Waiting 0.900 sec 37.5/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(6)
0:42.411 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(6)
0:43.416 slice_and_dice Fluffy_Pillow 47.1/135: 35% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(5)
0:44.421 sinister_strike Fluffy_Pillow 62.6/135: 46% energy | 1.0/5: 20% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(5)
0:45.427 Waiting 0.500 sec 43.1/135: 32% energy | 3.0/5: 60% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(4)
0:45.927 sinister_strike Fluffy_Pillow 50.8/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(4)
0:46.932 Waiting 0.600 sec 31.1/135: 23% energy | 4.0/5: 80% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(4)
0:47.532 revealing_strike Fluffy_Pillow 40.3/135: 30% energy | 4.0/5: 80% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(3)
0:48.537 Waiting 2.329 sec 15.5/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(3)
0:50.866 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(2)
0:51.870 Waiting 1.341 sec 15.5/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong
0:53.211 eviscerate Fluffy_Pillow 35.4/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong
0:54.215 Waiting 0.700 sec 40.2/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice
0:54.915 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice
0:55.920 killing_spree Fluffy_Pillow 30.3/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2)
0:59.155 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2)
1:00.160 sinister_strike Fluffy_Pillow 114.8/135: 85% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(3)
1:01.165 eviscerate Fluffy_Pillow 81.0/135: 60% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(5), mark_of_warsong(10)
1:02.171 eviscerate Fluffy_Pillow 117.2/135: 87% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(9)
1:03.178 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(9)
1:04.182 sinister_strike Fluffy_Pillow 101.0/135: 75% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(8)
1:05.186 sinister_strike Fluffy_Pillow 66.9/135: 50% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(8)
1:06.189 Waiting 0.100 sec 47.8/135: 35% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7)
1:06.289 sinister_strike Fluffy_Pillow 64.4/135: 48% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7)
1:07.294 eviscerate Fluffy_Pillow 45.2/135: 33% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7)
1:08.297 sinister_strike Fluffy_Pillow 65.9/135: 49% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6)
1:09.302 Waiting 1.200 sec 31.5/135: 23% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6)
1:10.502 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5)
1:11.507 Waiting 0.800 sec 30.7/135: 23% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5)
1:12.307 sinister_strike Fluffy_Pillow 58.0/135: 43% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4)
1:13.310 Waiting 1.111 sec 23.3/135: 17% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4)
1:14.421 revealing_strike Fluffy_Pillow 40.2/135: 30% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3)
1:15.425 Waiting 1.331 sec 15.4/135: 11% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_warsong(3)
1:16.756 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_warsong(2)
1:17.761 Waiting 0.728 sec 15.6/135: 12% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation, mark_of_warsong(2)
1:18.489 slice_and_dice Fluffy_Pillow 26.4/135: 20% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation, mark_of_warsong
1:19.492 Waiting 0.600 sec 41.3/135: 31% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong
1:20.092 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong
1:21.098 Waiting 0.600 sec 30.1/135: 22% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, anticipation, exquisite_proficiency
1:21.698 sinister_strike Fluffy_Pillow 53.9/135: 40% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, anticipation, exquisite_proficiency
1:22.703 Waiting 2.128 sec 18.7/135: 14% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency
1:24.831 sinister_strike Fluffy_Pillow 65.0/135: 48% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency
1:25.835 Waiting 0.400 sec 44.8/135: 33% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
1:26.235 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
1:27.241 adrenaline_rush Fluffy_Pillow 30.5/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
1:27.241 potion Fluffy_Pillow 30.5/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
1:27.241 Waiting 0.700 sec 30.5/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, draenic_agility_potion
1:27.941 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, draenic_agility_potion
1:28.746 sinister_strike Fluffy_Pillow 54.8/135: 41% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(4), exquisite_proficiency, draenic_agility_potion
1:29.551 Waiting 0.300 sec 28.5/135: 21% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(5), exquisite_proficiency, draenic_agility_potion
1:29.851 eviscerate Fluffy_Pillow 37.3/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(5), exquisite_proficiency, draenic_agility_potion
1:30.654 use_item_turbulent_vial_of_toxin Fluffy_Pillow 65.9/135: 49% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, draenic_agility_potion
1:30.654 sinister_strike Fluffy_Pillow 65.9/135: 49% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:31.457 sinister_strike Fluffy_Pillow 54.6/135: 40% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:32.262 sinister_strike Fluffy_Pillow 58.3/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:33.067 Waiting 0.200 sec 32.0/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:33.267 eviscerate Fluffy_Pillow 37.9/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:34.070 sinister_strike Fluffy_Pillow 81.5/135: 60% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:34.877 sinister_strike Fluffy_Pillow 85.2/135: 63% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:35.680 eviscerate Fluffy_Pillow 59.8/135: 44% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(10), draenic_agility_potion, turbulent_vial_of_toxin
1:36.483 eviscerate Fluffy_Pillow 75.7/135: 56% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10), draenic_agility_potion, turbulent_vial_of_toxin
1:37.288 sinister_strike Fluffy_Pillow 106.7/135: 79% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10), draenic_agility_potion, turbulent_vial_of_toxin
1:38.093 sinister_strike Fluffy_Pillow 97.4/135: 72% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), draenic_agility_potion, turbulent_vial_of_toxin
1:38.898 sinister_strike Fluffy_Pillow 73.2/135: 54% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), draenic_agility_potion, turbulent_vial_of_toxin
1:39.700 revealing_strike Fluffy_Pillow 48.7/135: 36% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(8), draenic_agility_potion, turbulent_vial_of_toxin
1:40.503 Waiting 0.100 sec 34.1/135: 25% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(8), draenic_agility_potion, turbulent_vial_of_toxin
1:40.603 eviscerate Fluffy_Pillow 37.3/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(8), draenic_agility_potion, turbulent_vial_of_toxin
1:41.407 sinister_strike Fluffy_Pillow 52.7/135: 39% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
1:42.210 Waiting 0.100 sec 28.0/135: 21% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
1:42.310 vanish Fluffy_Pillow 30.0/135: 22% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
1:42.310 ambush Fluffy_Pillow 30.0/135: 22% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
1:43.317 killing_spree Fluffy_Pillow 30.8/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
1:46.646 eviscerate Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5), draenic_agility_potion
1:47.651 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4), draenic_agility_potion
1:48.654 sinister_strike Fluffy_Pillow 100.3/135: 74% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4), draenic_agility_potion
1:49.659 sinister_strike Fluffy_Pillow 65.6/135: 49% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3), draenic_agility_potion
1:50.662 Waiting 0.300 sec 45.8/135: 34% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_warsong(3), draenic_agility_potion
1:50.962 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_warsong(3), draenic_agility_potion
1:51.965 Waiting 1.336 sec 15.5/135: 11% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, mark_of_warsong(2), draenic_agility_potion
1:53.301 slice_and_dice Fluffy_Pillow 50.5/135: 37% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, mark_of_warsong(2)
1:54.306 sinister_strike Fluffy_Pillow 65.4/135: 48% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice, mark_of_warsong
1:55.311 Waiting 1.400 sec 30.4/135: 22% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong
1:56.711 sinister_strike Fluffy_Pillow 51.0/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice
1:57.714 Waiting 1.729 sec 15.7/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice
1:59.443 revealing_strike Fluffy_Pillow 41.2/135: 30% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice
2:00.447 Waiting 2.314 sec 16.0/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice
2:02.761 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice
2:03.766 Waiting 2.393 sec 14.8/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation
2:06.159 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation
2:07.162 Waiting 1.400 sec 29.8/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2)
2:08.562 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2)
2:09.564 Waiting 1.370 sec 15.1/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3)
2:10.934 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3)
2:11.938 Waiting 0.400 sec 30.1/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(5)
2:12.338 eviscerate Fluffy_Pillow 36.0/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(5)
2:13.343 sinister_strike Fluffy_Pillow 55.7/135: 41% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice
2:14.349 Waiting 2.002 sec 20.5/135: 15% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2)
2:16.351 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2)
2:17.354 Waiting 2.394 sec 14.8/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(3)
2:19.748 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(3)
2:20.753 Waiting 0.693 sec 14.8/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(4)
2:21.446 eviscerate Fluffy_Pillow 40.0/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(4)
2:22.450 sinister_strike Fluffy_Pillow 59.8/135: 44% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice
2:23.454 Waiting 0.800 sec 24.5/135: 18% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(2)
2:24.254 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(2)
2:25.258 Waiting 1.304 sec 16.1/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(3)
2:26.562 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(3)
2:27.568 revealing_strike Fluffy_Pillow 55.1/135: 41% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice
2:28.572 Waiting 0.400 sec 29.9/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
2:28.972 eviscerate Fluffy_Pillow 35.8/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
2:29.976 Waiting 0.700 sec 40.5/135: 30% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
2:30.676 sinister_strike Fluffy_Pillow 50.8/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
2:31.682 Waiting 2.335 sec 15.6/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
2:34.017 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
2:35.020 Waiting 0.895 sec 14.8/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
2:35.915 eviscerate Fluffy_Pillow 42.9/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
2:36.920 sinister_strike Fluffy_Pillow 62.7/135: 46% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
2:37.925 Waiting 0.200 sec 27.5/135: 20% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
2:38.125 slice_and_dice Fluffy_Pillow 30.5/135: 23% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
2:39.128 Waiting 0.400 sec 45.2/135: 34% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
2:39.528 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 1.0/5: 20% combo_points slice_and_dice, exquisite_proficiency
2:40.533 Waiting 1.300 sec 30.9/135: 23% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice, exquisite_proficiency
2:41.833 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice, exquisite_proficiency
2:42.836 Waiting 0.693 sec 14.8/135: 11% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
2:43.529 vanish Fluffy_Pillow 25.0/135: 19% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
2:43.529 ambush Fluffy_Pillow 25.0/135: 19% energy | 3.0/5: 60% combo_points bandits_guile(2), stealth, vanish, slice_and_dice, exquisite_proficiency
2:44.533 killing_spree Fluffy_Pillow 24.8/135: 18% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
2:47.820 slice_and_dice Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
2:48.826 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
2:49.830 sinister_strike Fluffy_Pillow 114.8/135: 85% energy | 2.0/5: 40% combo_points bandits_guile(3), slice_and_dice, exquisite_proficiency
2:50.834 revealing_strike Fluffy_Pillow 79.6/135: 59% energy | 4.0/5: 80% combo_points bandits_guile(4), shallow_insight, slice_and_dice, exquisite_proficiency
2:51.839 sinister_strike Fluffy_Pillow 54.3/135: 40% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, exquisite_proficiency
2:52.844 adrenaline_rush Fluffy_Pillow 19.1/135: 14% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
2:52.844 Waiting 1.098 sec 19.1/135: 14% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
2:53.942 sinister_strike Fluffy_Pillow 66.5/135: 49% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
2:54.747 Waiting 0.400 sec 40.1/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2)
2:55.147 sinister_strike Fluffy_Pillow 51.9/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2)
2:55.951 eviscerate Fluffy_Pillow 40.6/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(4)
2:56.756 sinister_strike Fluffy_Pillow 69.3/135: 51% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice
2:57.561 Waiting 0.300 sec 43.0/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation
2:57.861 sinister_strike Fluffy_Pillow 51.8/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation
2:58.667 Waiting 0.900 sec 25.5/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2)
2:59.567 sinister_strike Fluffy_Pillow 52.0/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2)
3:00.372 Waiting 0.300 sec 25.7/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3)
3:00.672 use_item_turbulent_vial_of_toxin Fluffy_Pillow 34.5/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3)
3:00.672 Waiting 0.400 sec 34.5/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), turbulent_vial_of_toxin
3:01.072 sinister_strike Fluffy_Pillow 61.3/135: 45% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), turbulent_vial_of_toxin
3:01.876 eviscerate Fluffy_Pillow 50.0/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), turbulent_vial_of_toxin
3:02.680 sinister_strike Fluffy_Pillow 64.6/135: 48% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, mark_of_warsong(10), turbulent_vial_of_toxin
3:03.485 eviscerate Fluffy_Pillow 40.6/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation, mark_of_warsong(10), turbulent_vial_of_toxin
3:04.291 sinister_strike Fluffy_Pillow 56.6/135: 42% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(10), turbulent_vial_of_toxin
3:05.097 Waiting 0.600 sec 32.3/135: 24% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(9), turbulent_vial_of_toxin
3:05.697 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(9), turbulent_vial_of_toxin
3:06.505 eviscerate Fluffy_Pillow 42.3/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(8), turbulent_vial_of_toxin
3:07.311 sinister_strike Fluffy_Pillow 57.8/135: 43% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(8), turbulent_vial_of_toxin
3:08.114 Waiting 0.400 sec 44.0/135: 33% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(8), turbulent_vial_of_toxin
3:08.514 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7), turbulent_vial_of_toxin
3:09.519 Waiting 1.468 sec 16.1/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7), turbulent_vial_of_toxin
3:10.987 sinister_strike Fluffy_Pillow 54.0/135: 40% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6), turbulent_vial_of_toxin
3:11.990 Waiting 1.044 sec 19.6/135: 15% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6), turbulent_vial_of_toxin
3:13.034 eviscerate Fluffy_Pillow 35.8/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5), turbulent_vial_of_toxin
3:14.038 Waiting 0.600 sec 41.3/135: 31% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5), turbulent_vial_of_toxin
3:14.638 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4), turbulent_vial_of_toxin
3:15.642 Waiting 2.001 sec 15.8/135: 12% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4), turbulent_vial_of_toxin
3:17.643 revealing_strike Fluffy_Pillow 46.2/135: 34% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3)
3:18.646 Waiting 1.000 sec 36.3/135: 27% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_warsong(2)
3:19.646 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_warsong(2)
3:20.649 Waiting 1.283 sec 16.3/135: 12% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, mark_of_warsong
3:21.932 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, mark_of_warsong
3:22.935 Waiting 0.765 sec 15.2/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation
3:23.700 slice_and_dice Fluffy_Pillow 26.5/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation
3:24.706 Waiting 0.600 sec 41.3/135: 31% energy | 1.0/5: 20% combo_points bandits_guile(2), slice_and_dice, anticipation
3:25.306 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(2), slice_and_dice, anticipation
3:26.310 Waiting 1.387 sec 14.9/135: 11% energy | 3.0/5: 60% combo_points bandits_guile(3), slice_and_dice, anticipation
3:27.697 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(3), slice_and_dice, anticipation
3:28.703 Waiting 2.372 sec 15.1/135: 11% energy | 4.0/5: 80% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation
3:31.075 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 4.0/5: 80% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation
3:32.080 Waiting 2.292 sec 14.8/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation
3:34.372 sinister_strike Fluffy_Pillow 63.5/135: 47% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation
3:35.378 Waiting 0.500 sec 43.3/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2)
3:35.878 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2)
3:36.883 Waiting 2.346 sec 15.5/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(3)
3:39.229 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(3)
3:40.233 Waiting 1.393 sec 14.8/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(4)
3:41.626 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(4)
3:42.632 revealing_strike Fluffy_Pillow 55.1/135: 41% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice
3:43.638 vanish Fluffy_Pillow 29.9/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation, exquisite_proficiency
3:43.638 ambush Fluffy_Pillow 29.9/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, stealth, vanish, slice_and_dice, anticipation, exquisite_proficiency
3:44.643 sinister_strike Fluffy_Pillow 59.7/135: 44% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:45.645 killing_spree Fluffy_Pillow 24.4/135: 18% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency
3:48.966 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency
3:49.972 eviscerate Fluffy_Pillow 114.8/135: 85% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(5), exquisite_proficiency
3:50.976 sinister_strike Fluffy_Pillow 134.6/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, exquisite_proficiency
3:51.980 sinister_strike Fluffy_Pillow 99.4/135: 74% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation, exquisite_proficiency
3:52.984 eviscerate Fluffy_Pillow 64.1/135: 48% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(2), exquisite_proficiency
3:53.987 sinister_strike Fluffy_Pillow 68.9/135: 51% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
3:54.991 Waiting 1.200 sec 33.7/135: 25% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
3:56.191 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
3:57.195 Waiting 0.300 sec 31.1/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, exquisite_proficiency
3:57.495 eviscerate Fluffy_Pillow 35.5/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, exquisite_proficiency
3:58.501 Waiting 0.300 sec 40.3/135: 30% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
3:58.801 sinister_strike Fluffy_Pillow 59.7/135: 44% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
3:59.804 Waiting 0.600 sec 24.5/135: 18% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
4:00.404 revealing_strike Fluffy_Pillow 48.3/135: 36% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
4:01.409 Waiting 0.527 sec 23.1/135: 17% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
4:01.936 eviscerate Fluffy_Pillow 45.9/135: 34% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
4:02.940 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:03.945 Waiting 2.348 sec 15.4/135: 11% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:06.293 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:07.296 Waiting 0.895 sec 14.8/135: 11% energy | 4.0/5: 80% combo_points slice_and_dice
4:08.191 slice_and_dice Fluffy_Pillow 27.9/135: 21% energy | 4.0/5: 80% combo_points slice_and_dice
4:09.197 Waiting 0.500 sec 42.7/135: 32% energy | 1.0/5: 20% combo_points slice_and_dice
4:09.697 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_warsong(10)
4:10.701 Waiting 1.234 sec 16.4/135: 12% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice, mark_of_warsong(10)
4:11.935 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice, mark_of_warsong(9)
4:12.939 adrenaline_rush Fluffy_Pillow 17.3/135: 13% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong(9)
4:12.939 Waiting 1.083 sec 17.3/135: 13% energy | 3.0/5: 60% combo_points bandits_guile(2), adrenaline_rush, slice_and_dice, mark_of_warsong(9)
4:14.022 sinister_strike Fluffy_Pillow 51.8/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(2), adrenaline_rush, slice_and_dice, mark_of_warsong(8)
4:14.826 Waiting 0.300 sec 42.2/135: 31% energy | 4.0/5: 80% combo_points bandits_guile(3), adrenaline_rush, slice_and_dice, mark_of_warsong(8)
4:15.126 sinister_strike Fluffy_Pillow 51.7/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(3), adrenaline_rush, slice_and_dice, mark_of_warsong(8)
4:15.929 Waiting 0.800 sec 27.1/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(4), adrenaline_rush, shallow_insight, slice_and_dice, mark_of_warsong(7)
4:16.729 sinister_strike Fluffy_Pillow 67.2/135: 50% energy | 5.0/5: 100% combo_points bandits_guile(4), adrenaline_rush, shallow_insight, slice_and_dice, mark_of_warsong(7)
4:17.533 Waiting 0.300 sec 42.5/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, mark_of_warsong(7)
4:17.833 sinister_strike Fluffy_Pillow 51.8/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, mark_of_warsong(6)
4:18.637 Waiting 0.600 sec 26.9/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(6)
4:19.237 sinister_strike Fluffy_Pillow 60.5/135: 45% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(6)
4:20.042 eviscerate Fluffy_Pillow 35.5/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(4), mark_of_warsong(5)
4:20.846 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, mark_of_warsong(5)
4:21.652 Waiting 0.900 sec 25.1/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(4)
4:22.552 sinister_strike Fluffy_Pillow 52.6/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(4)
4:23.356 Waiting 0.800 sec 27.2/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong(4)
4:24.156 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong(3)
4:24.959 Waiting 0.400 sec 25.8/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(5), mark_of_warsong(3)
4:25.359 eviscerate Fluffy_Pillow 37.9/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(5), mark_of_warsong(3)
4:26.162 sinister_strike Fluffy_Pillow 67.1/135: 50% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, mark_of_warsong(2)
4:26.968 Waiting 0.300 sec 41.2/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(2)
4:27.268 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(2)
4:28.074 Waiting 0.183 sec 22.3/135: 16% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(3), mark_of_warsong
4:28.257 eviscerate Fluffy_Pillow 40.0/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(3), mark_of_warsong
4:29.262 revealing_strike Fluffy_Pillow 44.9/135: 33% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong
4:30.267 Waiting 0.100 sec 34.8/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:30.367 eviscerate Fluffy_Pillow 36.2/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:31.370 use_item_turbulent_vial_of_toxin Fluffy_Pillow 41.0/135: 30% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:31.370 Waiting 0.700 sec 41.0/135: 30% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:32.070 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:33.075 killing_spree Fluffy_Pillow 31.1/135: 23% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:36.440 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:37.445 sinister_strike Fluffy_Pillow 114.8/135: 85% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:38.449 slice_and_dice Fluffy_Pillow 79.6/135: 59% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:39.454 sinister_strike Fluffy_Pillow 109.4/135: 81% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:40.458 sinister_strike Fluffy_Pillow 74.1/135: 55% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:41.463 Waiting 0.800 sec 38.9/135: 29% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:42.263 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
4:43.266 Waiting 0.648 sec 15.5/135: 11% energy | 5.0/5: 100% combo_points slice_and_dice, turbulent_vial_of_toxin
4:43.914 vanish Fluffy_Pillow 25.0/135: 19% energy | 5.0/5: 100% combo_points slice_and_dice, turbulent_vial_of_toxin
4:43.914 ambush Fluffy_Pillow 25.0/135: 19% energy | 5.0/5: 100% combo_points stealth, vanish, slice_and_dice, turbulent_vial_of_toxin
4:44.918 Waiting 1.800 sec 24.8/135: 18% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2), turbulent_vial_of_toxin
4:46.718 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
4:47.722 Waiting 1.308 sec 16.0/135: 12% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation(3)
4:49.030 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation(3)
4:50.036 Waiting 0.400 sec 30.1/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(4), exquisite_proficiency
4:50.436 eviscerate Fluffy_Pillow 36.0/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(4), exquisite_proficiency
4:51.441 Waiting 0.200 sec 40.8/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
4:51.641 revealing_strike Fluffy_Pillow 43.7/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
4:52.645 Waiting 1.642 sec 18.5/135: 14% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation, exquisite_proficiency
4:54.287 sinister_strike Fluffy_Pillow 57.7/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation, exquisite_proficiency
4:55.289 Waiting 0.900 sec 37.4/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation(2), exquisite_proficiency
4:56.189 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation(2), exquisite_proficiency
4:57.194 Waiting 1.049 sec 15.4/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(4), exquisite_proficiency

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 1262 1202 1202
Agility 3860 3414 3316 (1130)
Stamina 3876 3524 3524
Intellect 746 711 711
Spirit 533 533 533
Health 232560 211440 0
Energy 135 135 0
Combo Points 5 5 0
Crit 22.89% 17.89% 318
Haste 16.80% 10.18% 909
Multistrike 8.82% 3.82% 252
Damage / Heal Versatility 6.46% 3.46% 450
Attack Power 5944 4780 0
Mastery 38.24% 28.24% 673
Armor 824 824 824

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Cloak and Dagger Shadowstep Burst of Speed
75 Prey on the Weak Internal Bleeding Dirty Tricks
90 Shuriken Toss Marked for Death Anticipation
100 Venom Rush Shadow Reflection Death from Above

Profile

rogue="Ralana"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ralana/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/114/47730546-avatar.jpg"
level=100
race=night_elf
role=attack
position=back
professions=engineering=659/jewelcrafting=657
talents=http://eu.battle.net/wow/en/tool/talent-calculator#cZ!2221020
glyphs=energy/feint/disappearance/poisons/safe_fall/decoy
spec=combat

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=frosty_stew
actions.precombat+=/apply_poison,lethal=deadly
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/stealth
actions.precombat+=/marked_for_death
actions.precombat+=/slice_and_dice,if=talent.marked_for_death.enabled

# Executed every time the actor is available.

actions=potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|(buff.adrenaline_rush.up&(trinket.proc.any.react|trinket.stacking_proc.any.react|buff.archmages_greater_incandescence_agi.react))
actions+=/kick
actions+=/preparation,if=!buff.vanish.up&cooldown.vanish.remains>30
actions+=/use_item,slot=trinket1
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=energy<60
actions+=/blade_flurry,if=(active_enemies>=2&!buff.blade_flurry.up)|(active_enemies<2&buff.blade_flurry.up)
actions+=/shadow_reflection,if=(cooldown.killing_spree.remains<10&combo_points>3)|buff.adrenaline_rush.up
actions+=/ambush
actions+=/vanish,if=time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2|((target.time_to_die>45&combo_points=5&buff.slice_and_dice.remains<12)&buff.deep_insight.down)
actions+=/call_action_list,name=adrenaline_rush,if=(energy<35|buff.bloodlust.up)&cooldown.killing_spree.remains>10
actions+=/call_action_list,name=killing_spree,if=(energy<40|(buff.bloodlust.up&time<10)|buff.bloodlust.remains>20)&buff.adrenaline_rush.down&(!talent.shadow_reflection.enabled|cooldown.shadow_reflection.remains>30|buff.shadow_reflection.remains>3)
actions+=/marked_for_death,if=combo_points<=1&dot.revealing_strike.ticking&(!talent.shadow_reflection.enabled|buff.shadow_reflection.up|cooldown.shadow_reflection.remains>30)
actions+=/call_action_list,name=generator,if=combo_points<5|!dot.revealing_strike.ticking|(talent.anticipation.enabled&anticipation_charges<=4&buff.deep_insight.down)
actions+=/call_action_list,name=finisher,if=combo_points=5&dot.revealing_strike.ticking&(buff.deep_insight.up|!talent.anticipation.enabled|(talent.anticipation.enabled&anticipation_charges>=4))

actions.adrenaline_rush=adrenaline_rush,if=time_to_die>=44
actions.adrenaline_rush+=/adrenaline_rush,if=time_to_die<44&(buff.archmages_greater_incandescence_agi.react|trinket.proc.any.react|trinket.stacking_proc.any.react)
actions.adrenaline_rush+=/adrenaline_rush,if=time_to_die<=buff.adrenaline_rush.duration*1.5

actions.killing_spree=killing_spree,if=time_to_die>=44
actions.killing_spree+=/killing_spree,if=time_to_die<44&buff.archmages_greater_incandescence_agi.react&buff.archmages_greater_incandescence_agi.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<44&trinket.proc.any.react&trinket.proc.any.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<44&trinket.stacking_proc.any.react&trinket.stacking_proc.any.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<=buff.killing_spree.duration*1.5

# Combo point generators

actions.generator=revealing_strike,if=(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
actions.generator+=/sinister_strike,if=dot.revealing_strike.ticking

# Combo point finishers

actions.finisher=death_from_above
actions.finisher+=/eviscerate

head=nightvision_mechshades,id=109171,bonus_id=179/525/531
neck=shifting_taladite_pendant,id=115800,bonus_id=204/525/540,enchant=40haste
shoulders=spaulders_of_burning_focus,id=109934,bonus_id=524
back=barkwound_woodcloak,id=114482,bonus_id=214,enchant=100haste
chest=bloodfeather_chestwrap,id=109885,bonus_id=524
shirt=precious_ribbon,id=52019
tabard=stormwind_tabard,id=118365
wrists=spireflame_bracers,id=114433,bonus_id=132
hands=bloodfeather_grips,id=109849,bonus_id=499/524
waist=bloodfeather_girdle,id=109830,bonus_id=524
legs=leafmender_legwraps,id=109812,bonus_id=524
feet=blackwater_boots,id=109799,bonus_id=40/499/523/524,gems=35haste
finger1=signet_of_radiant_leaves,id=109762,bonus_id=499/523/524,gems=35haste,enchant=30haste
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=50haste
trinket1=turbulent_vial_of_toxin,id=114488,bonus_id=560
trinket2=voidtouched_totem,id=114891
main_hand=the_bladefist,id=113591,bonus_id=566,enchant=mark_of_warsong
off_hand=bloodblade_of_terongor,id=110049,bonus_id=499/524

# Gear Summary
# gear_agility=1964
# gear_stamina=2634
# gear_crit_rating=318
# gear_haste_rating=866
# gear_mastery_rating=673
# gear_armor=824
# gear_multistrike_rating=252
# gear_versatility_rating=450
# gear_avoidance_rating=76

Mîrai

Mîrai : 23742 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
23741.5 23741.5 7.3 / 0.031% 2303.0 / 9.7% 1092.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
20.8 20.8 Energy 40.94% 39.9 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Mîrai/advanced
Talents
  • 15: Subterfuge
  • 30: Nerve Strike
  • 45: Cheat Death
  • 60: Shadowstep
  • 75: Prey on the Weak
  • 90: Anticipation
  • 100: Shadow Reflection
  • Talent Calculator
Glyphs
  • Glyph of Hemorrhaging Veins
  • Glyph of Cloak of Shadows
  • Glyph of Energy
  • Glyph of Poisons
  • Glyph of Safe Fall
Professions
  • leatherworking: 700
  • jewelcrafting: 700

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=M%C3%AErai+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:69660|35963|24791|10086|9728|4608|2262&chds=0,139319&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++69660++rupture,C79C6E,0,0,15|t++35963++eviscerate,C79C6E,1,0,15|t++24791++ambush,C79C6E,2,0,15|t++10086++garrote,C79C6E,3,0,15|t++9728++backstab,C79C6E,4,0,15|t++4608++auto_attack_mh,C79C6E,5,0,15|t++2262++auto_attack_oh,C79C6E,6,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=M%C3%AErai+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:20,18,17,12,12,10,4,4,3,2,1,1,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=auto_attack_mh|eviscerate|rupture|backstab|ambush|auto_attack_oh|deadly_poison_instant|deadly_poison_dot|shattered_bleed|shadow_reflection: ambush|shadow_reflection: rupture|shadow_reflection: eviscerate|garrote|shadow_reflection: backstab&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=M%C3%AErai+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:fhlrtwz3587635110zxvrsqmljjihffffefffgghgggfffdccccbbdcdbbaZaZabbcccccefeccbcaaaZZYXWVVUUUTSSSSTSSSSSSSSRSSSTSTTUUWWYZZabcfghiijjjjjiiggffgfffdddddccdddcdddccbaYXXVUUTTSSSRSTUUVWWXYYZbcddddeefedccbaZYYYWVUTTTSSSSSSSSSSTTTTTTTTTTUUUVVWXXYYZZabbccdeffggghghhhiiiiiiihhggfedcbaZYYXWVUUTTTTTTTTTTTTUUUUUUVVVVWWWXXXYYZZZaabbbbbbbaaaaZaaaaaaaaaaaaZZZZaaaaaZZZZZZZZZZZYYYXWUTSQPOMK&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.47155,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=23742|max=50348&chxp=1,1,47,100 http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=M%C3%AErai+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,3,5,12,31,25,42,85,125,166,251,347,447,562,746,919,1019,1183,1317,1428,1464,1404,1413,1465,1340,1298,1182,1135,977,822,749,637,557,456,334,280,216,158,129,83,74,43,22,21,9,8,5,2,2&chds=0,1465&chbh=5&chxt=x&chxl=0:|min=21631|avg=23742|max=26042&chxp=0,1,48,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=M%C3%AErai+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:27.8,11.6,10.8,5.5,2.6,0.4,0.3,40.9&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=backstab 83.6s|eviscerate 35.0s|ambush 32.4s|rupture 16.6s|slice_and_dice 7.9s|preparation 1.2s|garrote 1.0s|waiting 123.2s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% M-Count M-Hit M-Crit M-Crit% Up%
Mîrai 23742
ambush 2682 11.3% 32.3 9.11sec 24903 24791 Direct 32.3 17050 35456 22095 27.4% 0.0% 12.5 5633 11613 27.4%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.30 32.30 0.00 0.00 1.0045 0.0000 804256.03 873554.24 7.93 24791.35 24791.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.42 27.41% 11613.24 8737 14689 11254.31 0 14689 39688 39688 0.00
multistrike 9.05 72.59% 5632.66 4283 7200 5636.88 0 7200 50987 50987 0.00
hit 23.44 72.59% 17049.63 9289 24002 17064.52 15015 19266 399692 440236 9.21
crit 8.85 27.41% 35455.51 18950 48963 35498.13 0 48963 313890 342643 8.41
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
auto_attack_mh 4583 19.3% 319.0 0.94sec 4315 4608 Direct 319.0 3564 7519 3887 25.3% 19.0% 99.6 1072 2257 25.4%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 319.05 319.05 0.00 0.00 0.9365 0.0000 1376692.18 1644604.49 16.29 4607.54 4607.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 25.25 25.36% 2256.66 1373 3552 2258.66 1765 2795 56975 67259 15.29
multistrike 74.30 74.64% 1071.59 673 1741 1072.37 946 1213 79622 96003 17.05
hit 177.68 55.69% 3563.60 2243 5804 3566.08 3356 3816 633198 764642 17.17
crit 80.72 25.30% 7518.62 4576 11840 7525.96 6583 8515 606896 716701 15.29
miss 60.64 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2248 9.5% 316.4 0.95sec 2134 2262 Direct 316.4 1763 3719 1923 25.3% 19.0% 98.8 530 1116 25.3%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 316.45 316.45 0.00 0.00 0.9436 0.0000 675376.50 809237.15 16.54 2261.76 2261.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.97 25.28% 1115.93 682 1767 1117.01 844 1423 27864 32993 15.55
multistrike 73.80 74.72% 530.26 334 866 530.65 463 599 39133 47311 17.27
hit 176.24 55.69% 1762.58 1115 2887 1763.87 1647 1884 310637 376264 17.42
crit 80.06 25.30% 3718.82 2274 5890 3722.15 3278 4235 297743 352668 15.55
miss 60.15 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
backstab 2704 11.4% 83.2 3.44sec 9772 9728 Direct 83.2 6913 14491 8760 24.4% 0.0% 32.0 2074 4348 24.4%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.21 83.21 0.00 0.00 1.0045 0.0000 813077.30 1022446.37 20.48 9728.25 9728.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.81 24.40% 4348.26 2836 6372 4349.81 0 6372 33980 42191 19.53
multistrike 24.21 75.60% 2073.55 1390 3123 2074.64 1668 2535 50204 63675 21.16
hit 62.92 75.62% 6912.86 4634 10411 6916.48 6286 7629 434978 551623 21.12
crit 20.28 24.38% 14491.25 9454 21239 14506.40 11155 18568 293915 364957 19.44
 
DPS Timeline Chart
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Backstab the target, causing $sw2 Physical damage. Must not be in front of the target. Awards {$s3=1} combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
deadly_poison_dot 840 3.5% 199.5 1.51sec 1266 0 Periodic 99.5 1798 3701 2277 25.2% 0.0% 38.3 539 1111 25.2% 99.2%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 199.50 199.50 99.45 99.45 0.0000 3.0000 252599.03 252599.03 0.00 846.62 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.7 25.24% 1110.56 887 1536 1110.85 0 1536 10734 10734 0.00
multistrike 28.6 74.76% 539.43 435 753 539.62 513 585 15442 15442 0.00
hit 74.4 74.84% 1797.92 5 2510 1798.50 1749 1843 133826 133826 0.00
crit 25.0 25.16% 3700.99 75 5121 3702.91 3459 4136 92597 92597 0.00
 
DPS Timeline Chart
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance of poisoning the enemy for ${$2818m1*4} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250140
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
deadly_poison_instant 872 3.7% 198.5 1.51sec 1321 0 Direct 198.5 933 1925 1184 25.3% 0.0% 76.4 280 578 25.3%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.50 198.50 0.00 0.00 0.0000 0.0000 262165.87 262165.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 19.31 25.27% 577.59 457 790 577.87 528 675 11155 11155 0.00
multistrike 57.11 74.73% 279.91 224 387 280.02 267 301 15985 15985 0.00
hit 148.28 74.70% 932.97 746 1292 933.38 909 970 138342 138342 0.00
crit 50.22 25.30% 1925.14 1522 2635 1926.12 1817 2086 96684 96684 0.00
 
DPS Timeline Chart
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
eviscerate 4186 17.6% 34.8 8.51sec 36125 35963 Direct 34.8 25300 53122 32393 25.5% 0.0% 13.4 7587 15928 25.6%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.80 34.80 0.00 0.00 1.0045 0.0000 1257118.80 1443178.38 12.89 35962.89 35962.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.42 25.61% 15928.28 11160 24742 15396.13 0 24742 54473 61970 11.95
multistrike 9.94 74.39% 7586.69 5471 12128 7591.38 0 10899 75380 87171 13.57
hit 25.93 74.51% 25299.78 18236 40428 25316.66 21549 29132 655964 758198 13.47
crit 8.87 25.49% 53122.14 37202 82473 53211.52 37202 82473 471302 535840 12.06
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.507760
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
garrote 34 0.1% 1.0 0.00sec 10122 10086 Periodic 9.0 746 1516 1008 34.1% 0.0% 3.5 224 455 34.0% 6.0%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 8.99 8.99 1.0045 2.0000 10115.78 10115.78 0.00 532.63 10085.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.2 33.97% 455.05 417 480 318.49 0 480 535 535 0.00
multistrike 2.3 66.03% 223.79 205 235 204.53 0 235 512 512 0.00
hit 5.9 65.94% 745.76 682 784 745.23 0 784 4423 4423 0.00
crit 3.1 34.06% 1516.42 1391 1600 1477.02 0 1600 4646 4646 0.00
 
DPS Timeline Chart
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&time<1
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:$w1 damage every $t1 seconds.
  • description:Garrote the enemy, silencing them for {$1330d=3 seconds} and causing $o1 damage over {$d=18 seconds}. Awards {$s3=1} combo $lpoint:points;{$?s138106=false}[ and causes you to appear behind the target][].{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.078000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
rupture 3846 16.2% 16.5 18.54sec 69972 69660 Periodic 190.3 4306 8862 5451 25.1% 0.0% 73.2 1292 2658 25.1% 126.5%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.53 16.53 190.25 190.25 1.0045 2.0000 1156769.80 1156769.80 0.00 2912.96 69659.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 18.4 25.07% 2657.86 2545 3672 2658.91 2545 3061 48779 48779 0.00
multistrike 54.8 74.93% 1291.93 1248 1800 1292.36 1248 1374 70862 70862 0.00
hit 142.4 74.86% 4306.05 4159 5999 4307.45 4230 4420 613279 613279 0.00
crit 47.8 25.14% 8861.58 8484 12239 8865.31 8527 9380 423851 423851 0.00
 
DPS Timeline Chart
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time. Lasts longer per combo point: 1 point : ${$<bonus>*1*0.0685*$AP*0.5*8} over 8 sec 2 points: ${$<bonus>*2*0.0685*$AP*0.5*12} over 12 sec 3 points: ${$<bonus>*3*0.0685*$AP*0.5*16} over 16 sec 4 points: ${$<bonus>*4*0.0685*$AP*0.5*20} over 20 sec 5 points: ${$<bonus>*5*0.0685*$AP*0.5*24} over 24 sec{$?s79134=false}[ While you have poisoned your target, this damage deals {$79136s1=0} additional Nature damage and grants you {$79134s2=10} Energy. You gain additional Energy if a target dies with Rupture active.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.068500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 743 3.1% 34.3 9.21sec 6515 0 Direct 34.3 1635 3340 2065 25.2% 0.0% 13.2 491 1002 25.2%  
Periodic 166.1 777 0 777 0.0% 0.0% 64.0 238 0 0.0% 55.2%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.27 34.27 166.10 166.10 0.0000 1.0000 223310.04 223310.04 0.00 1344.40 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.33 25.20% 1002.22 971 1116 963.16 0 1116 3337 3337 0.00
multistrike 9.88 74.80% 490.62 476 547 490.78 0 547 4849 4849 0.00
hit 25.64 74.81% 1635.47 1586 1824 1636.00 1586 1731 41937 41937 0.00
crit 8.63 25.19% 3340.30 3235 3720 3340.73 0 3720 28836 28836 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 64.0 100.00% 237.88 238 238 237.88 238 238 15227 15227 0.00
hit 166.1 100.00% 777.37 1 793 777.42 752 791 129125 129125 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - shadow_reflection 6724 / 1003
ambush 2924 1.8% 10.3 24.65sec 12691 0 Direct 10.3 8539 17258 11381 32.6% 0.0% 4.0 2560 5181 32.5%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.30 10.30 0.00 0.00 0.0000 0.0000 130778.29 200985.59 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.29 32.52% 5181.44 4679 5869 3799.52 0 5869 6666 10245 25.60
multistrike 2.67 67.48% 2559.82 2340 2935 2398.13 0 2935 6833 10501 32.67
hit 6.95 67.41% 8539.47 7799 9782 8560.02 0 9782 59314 91156 34.93
crit 3.36 32.59% 17258.13 15597 19564 16961.32 0 19564 57965 89083 34.25
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
backstab 11 0.0% 0.1 64.39sec 5697 0 Direct 0.1 3891 7781 5122 31.7% 0.0% 0.0 1167 2334 31.3%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.08 0.08 0.00 0.00 0.0000 0.0000 483.09 742.44 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.01 31.32% 2334.38 2334 2334 22.50 0 2334 23 36 0.34
multistrike 0.02 68.68% 1167.19 1167 1167 23.86 0 1167 25 39 0.71
hit 0.06 68.35% 3890.64 3891 3891 219.90 0 3891 226 347 1.97
crit 0.03 31.65% 7781.28 7781 7781 206.67 0 7781 209 321 0.93
 
DPS Timeline Chart
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Backstab the target, causing $sw2 Physical damage. Must not be in front of the target. Awards {$s3=1} combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
eviscerate 1558 1.0% 2.7 107.04sec 25693 0 Direct 2.7 17381 35211 23020 31.6% 0.0% 1.0 5210 10593 31.8%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.71 2.71 0.00 0.00 0.0000 0.0000 69742.32 107182.94 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.33 31.83% 10592.52 9574 12009 3040.65 0 12009 3533 5430 10.01
multistrike 0.71 68.17% 5209.60 4787 6005 2685.29 0 6005 3722 5720 17.94
hit 1.86 68.37% 17380.70 15957 20015 16084.43 0 20015 32255 49571 32.01
crit 0.86 31.63% 35210.65 31913 40031 22194.00 0 40031 30232 46462 21.90
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.577000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
rupture 2232 1.4% 1.8 162.64sec 55268 0 Periodic 21.0 3338 6825 4251 26.2% 0.0% 8.1 1001 2047 26.1% 14.0%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.80 1.80 20.99 20.99 0.0000 2.0000 99530.79 99530.79 0.00 2370.91 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.1 26.11% 2046.80 1921 2410 1748.48 0 2410 4323 4323 0.00
multistrike 6.0 73.89% 1001.41 961 1205 997.84 0 1205 5987 5987 0.00
hit 15.5 73.83% 3338.08 3202 4017 3361.59 0 3813 51731 51731 0.00
crit 5.5 26.17% 6824.81 6405 8034 6840.34 0 8034 37489 37489 0.00
 
DPS Timeline Chart
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time. Lasts longer per combo point: 1 point : ${$<bonus>*1*0.0685*$AP*0.5*8} over 8 sec 2 points: ${$<bonus>*2*0.0685*$AP*0.5*12} over 12 sec 3 points: ${$<bonus>*3*0.0685*$AP*0.5*16} over 16 sec 4 points: ${$<bonus>*4*0.0685*$AP*0.5*20} over 20 sec 5 points: ${$<bonus>*5*0.0685*$AP*0.5*24} over 24 sec{$?s79134=false}[ While you have poisoned your target, this damage deals {$79136s1=0} additional Nature damage and grants you {$79134s2=10} Energy. You gain additional Energy if a target dies with Rupture active.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.068500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Mîrai
draenic_agility_potion 1.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 1.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
premeditation 8.5 38.54sec

Stats details: premeditation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.51 8.51 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 8.51 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: premeditation

Static Values
  • id:14183
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
Spelldata
  • id:14183
  • name:Premeditation
  • school:physical
  • tooltip:
  • description:Adds {$s1=2} combo points. You must add to or use those combo points within {$d=18 seconds} or the combo points are lost.
 
preparation 1.2 312.71sec

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.17 1.17 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:
  • description:Immediately resets the cooldown on your Sprint, Vanish, and Evasion.
 
shadow_dance 5.3 61.89sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.29 5.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 5.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadow_dance

Static Values
  • id:51713
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
Spelldata
  • id:51713
  • name:Shadow Dance
  • school:physical
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by {$s2=20}.
  • description:Enter the Shadow Dance for {$d=8 seconds}, allowing the use of abilities that ordinarily require Stealth, and reducing the Energy cost of Ambush by {$s2=20}.
 
shadow_reflection 2.9 124.29sec

Stats details: shadow_reflection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 2.87 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 2.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadow_reflection

Static Values
  • id:152151
  • school:physical
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.shadow_dance.up
Spelldata
  • id:152151
  • name:Shadow Reflection
  • school:physical
  • tooltip:You have a Shadow Reflection, watching you and replicating your abilities used.
  • description:Summon a shadow of yourself on the target that will watch you and memorize your offensive ability usage for the next 8 sec. After this time, it will mimic the memorized abilities on its target over the next 8 sec.
 
slice_and_dice 8.8 35.85sec

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.82 8.82 0.00 0.00 0.8907 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 8.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
 
vanish 4.2 71.90sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.21 4.21 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 4.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for {$11327d=3 seconds}. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
anticipation 34.5 40.5 8.8sec 4.0sec 34.45% 34.46% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_anticipation
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • anticipation_1:12.59%
  • anticipation_2:5.60%
  • anticipation_3:5.66%
  • anticipation_4:6.51%
  • anticipation_5:4.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115189
  • name:Anticipation
  • tooltip:Your next offensive finishing move will grant you {$s1=1} combo points on that target.
  • description:{$@spelldesc114015=When one of your attacks generates a combo point while you already have 5 combo points, you gain an Anticipation charge. Performing an offensive finishing move consumes all Anticipation charges and grants you a combo point for each.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 28.65% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 1.0 0.0 0.0sec 0.0sec 6.76% 6.78% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
master_of_subtlety 5.1 0.0 61.0sec 61.0sec 10.20% 10.21% 5.0(5.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:10.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31666
  • name:Master of Subtlety
  • tooltip:
  • description:
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
master_of_subtlety_passive (_passive) 5.2 0.0 61.2sec 71.9sec 5.19% 5.20% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_master_of_subtlety_passive
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • master_of_subtlety_passive_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for 6 seconds after breaking stealth cause an additional {$s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadow_dance 5.3 0.0 61.9sec 61.9sec 17.33% 17.34% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_dance_1:17.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51713
  • name:Shadow Dance
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by {$s2=20}.
  • description:Enter the Shadow Dance for {$d=8 seconds}, allowing the use of abilities that ordinarily require Stealth, and reducing the Energy cost of Ambush by {$s2=20}.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
shadow_reflection 2.9 0.0 124.3sec 124.3sec 14.97% 14.98% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_shadow_reflection
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_reflection_1:14.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:152151
  • name:Shadow Reflection
  • tooltip:You have a Shadow Reflection, watching you and replicating your abilities used.
  • description:Summon a shadow of yourself on the target that will watch you and memorize your offensive ability usage for the next 8 sec. After this time, it will mimic the memorized abilities on its target over the next 8 sec.
  • max_stacks:0
  • duration:16.00
  • cooldown:120.00
  • default_chance:100.00%
slice_and_dice 2.2 6.6 132.1sec 35.9sec 99.73% 100.00% 156.2(156.2)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • slice_and_dice_1:99.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.1 0.0 117.9sec 117.9sec 19.70% 19.71% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
stealth 5.2 0.0 61.2sec 71.9sec 5.19% 5.20% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:0.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stealth_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}%. ]?s13975[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%. ][]{$?s31223=false}[Attacks from Stealth and for {$31666d=6 seconds} after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:6.00
  • default_chance:100.00%
subterfuge 5.2 0.0 61.2sec 71.9sec 5.19% 5.20% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • subterfuge_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:Your Stealth breaks {$d=3 seconds} after dealing or receiving damage, rather than immediately.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
vanish 4.2 0.0 71.9sec 71.9sec 4.17% 4.19% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vanish_1:4.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mîrai
ambush Energy 32.3 1469.8 45.5 45.5 547.2
backstab Energy 83.2 2912.2 35.0 35.0 279.2
eviscerate Energy 34.8 1218.0 35.0 35.0 1032.1
eviscerate Combo Points 34.8 174.0 5.0 5.0 7224.9
garrote Energy 1.0 45.0 45.0 45.0 224.9
rupture Energy 16.5 413.3 25.0 25.0 2798.9
rupture Combo Points 16.5 82.7 5.0 5.0 13994.3
slice_and_dice Energy 8.8 195.6 22.2 22.2 0.0
slice_and_dice Combo Points 8.8 44.1 5.0 5.0 0.0
Resource Gains Type Count Total Average Overflow
garrote Combo Points 1.00 1.00 (0.33%) 1.00 0.00 0.00%
ambush Combo Points 37.02 64.55 (21.50%) 1.74 0.00 0.00%
backstab Combo Points 83.21 83.21 (27.72%) 1.00 0.00 0.00%
energy_regen Energy 816.46 3483.17 (56.56%) 4.27 0.00 0.00%
external_healing Health 8.54 0.00 (0.00%) 0.00 78969.76 100.00%
energetic_recovery Energy 149.55 1196.37 (19.43%) 8.00 0.00 0.00%
honor_among_thieves Combo Points 135.62 135.62 (45.18%) 1.00 0.00 0.00%
premeditation Combo Points 8.47 15.83 (5.27%) 1.87 0.00 0.00%
relentless_strikes Energy 60.16 1478.90 (24.01%) 24.58 25.00 1.66%
Resource RPS-Gain RPS-Loss
Energy 20.47 20.78
Combo Points 0.99 1.00
Combat End Resource Mean Min Max
Energy 24.54 0.01 93.47
Combo Points 3.58 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.0%
shadow_reflection-Energy Cap 0.0%

Procs

Count Interval
Anticipation Charges (wasted) 0.7 87.8sec
Honor Among Thieves (Proxy action) 136.3 2.2sec

Statistics & Data Analysis

Fight Length
Sample Data Mîrai Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Mîrai Damage Per Second
Count 25000
Mean 23741.53
Minimum 21631.24
Maximum 26041.98
Spread ( max - min ) 4410.74
Range [ ( max - min ) / 2 * 100% ] 9.29%
Standard Deviation 591.5937
5th Percentile 22811.03
95th Percentile 24750.25
( 95th Percentile - 5th Percentile ) 1939.22
Mean Distribution
Standard Deviation 3.7416
95.00% Confidence Intervall ( 23734.19 - 23748.86 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2385
0.1 Scale Factor Error with Delta=300 2987
0.05 Scale Factor Error with Delta=300 11950
0.01 Scale Factor Error with Delta=300 298765
Distribution Chart
DPS(e)
Sample Data Mîrai Damage Per Second (Effective)
Count 25000
Mean 23741.53
Minimum 21631.24
Maximum 26041.98
Spread ( max - min ) 4410.74
Range [ ( max - min ) / 2 * 100% ] 9.29%
Damage
Sample Data Mîrai Damage
Count 25000
Mean 6831481.34
Minimum 5094577.98
Maximum 8774263.59
Spread ( max - min ) 3679685.61
Range [ ( max - min ) / 2 * 100% ] 26.93%
DTPS
Sample Data Mîrai Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mîrai Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Mîrai Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mîrai Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mîrai Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mîrai Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data MîraiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Mîrai Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=calamari_crepes
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_agility
5 0.00 stealth
6 0.00 slice_and_dice
7 0.00 honor_among_thieves,cooldown=2.2,cooldown_stddev=0.1
Proxy Honor Among Thieves action. Generates Combo Points at a mean rate of 2.2 seconds. Comment out to disable (and use the real Honor Among Thieves).
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|buff.shadow_dance.up&(trinket.proc.agi.react|trinket.proc.multistrike.react|trinket.stacking_proc.agi.react|trinket.stacking_proc.multistrike.react|buff.archmages_greater_incandescence_agi.react)
9 0.00 kick
A 2.87 shadow_reflection,if=buff.shadow_dance.up
B 0.00 blood_fury,if=buff.shadow_dance.up
C 0.00 berserking,if=buff.shadow_dance.up
D 0.00 arcane_torrent,if=energy<60&buff.shadow_dance.up
E 0.00 slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die&combo_points=((target.time_to_die-buff.slice_and_dice.remains)%6)+1
F 8.51 premeditation,if=combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
G 0.00 pool_resource,for_next=1
H 1.00 garrote,if=!ticking&time<1
I 2.49 wait,sec=1,if=buff.subterfuge.remains>1.1&buff.subterfuge.remains<1.3&time>6
J 0.00 pool_resource,for_next=1
K 32.30 ambush,if=combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
L 0.00 pool_resource,for_next=1,extra_amount=50
M 5.29 shadow_dance,if=energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
N 0.00 pool_resource,for_next=1,extra_amount=50
O 0.00 vanish,if=talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
P 0.00 pool_resource,for_next=1,extra_amount=90
Q 4.21 vanish,if=talent.subterfuge.enabled&energy>=90&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
R 0.00 marked_for_death,if=combo_points=0
S 0.00 run_action_list,name=generator,if=talent.anticipation.enabled&anticipation_charges<4&buff.slice_and_dice.up&dot.rupture.remains>2&(buff.slice_and_dice.remains<6|dot.rupture.remains<4)
T 0.00 run_action_list,name=finisher,if=combo_points=5
U 0.00 run_action_list,name=generator,if=combo_points<4|(combo_points=4&cooldown.honor_among_thieves.remains>1&energy>70-energy.regen)|talent.anticipation.enabled
V 0.00 run_action_list,name=pool
actions.generator Combo point generators
# count action,conditions
W 0.00 run_action_list,name=pool,if=buff.master_of_subtlety.down&buff.shadow_dance.down&debuff.find_weakness.down&(energy+cooldown.shadow_dance.remains*energy.regen<80|energy+cooldown.vanish.remains*energy.regen<60)
X 0.00 fan_of_knives,if=active_enemies>1
Y 0.00 shuriken_toss,if=energy<65&energy.regen<16
Z 83.21 backstab
a 0.00 hemorrhage,if=position_front
b 0.00 run_action_list,name=pool
actions.finisher Combo point finishers
# count action,conditions
c 16.53 rupture,cycle_targets=1,if=(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
d 7.82 slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die
e 0.00 death_from_above
f 0.00 crimson_tempest,if=(active_enemies>=3&dot.crimson_tempest_dot.ticks_remain<=2&combo_points=5)|active_enemies>=5&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
g 34.80 eviscerate,if=active_enemies<4|(active_enemies>3&dot.crimson_tempest_dot.ticks_remain>=2)&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
h 0.00 run_action_list,name=pool
actions.pool Resource pooling
# count action,conditions
i 1.17 preparation,if=!buff.vanish.up&cooldown.vanish.remains>60

Sample Sequence

0124567FHKMAKcKKgKgKgZZgZZZcQFKKidZZZggZZcQKIFKgZgZZZcMKKdKFgKKggZZZcZZgZZcZZZdZZgZZgZZcZZZgMAFKKgKcKgZZdZZgQFKIKcgZZZgZZgZZcZZZZZdMFKgKcKKggZZgZZZcZZdZZZgZZgZZcZZZgQFKgKdZZZcZMAKgKKgKgZcZZgZZZdZZZcZZgZZgZ

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points draenic_agility_potion
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points draenic_agility_potion
Pre slice_and_dice Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
Pre honor_among_thieves Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
0:00.000 premeditation Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/5: 40% combo_points slice_and_dice, draenic_agility_potion
0:01.005 ambush Fluffy_Pillow 89.5/120: 75% energy | 3.0/5: 60% combo_points bloodlust, subterfuge, slice_and_dice, draenic_agility_potion
0:02.009 shadow_dance Fluffy_Pillow 52.1/120: 43% energy | 5.0/5: 100% combo_points bloodlust, subterfuge, slice_and_dice, draenic_agility_potion
0:02.009 shadow_reflection Fluffy_Pillow 52.1/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, draenic_agility_potion
0:02.009 ambush Fluffy_Pillow 52.1/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, shadow_reflection, draenic_agility_potion
0:03.014 rupture Fluffy_Pillow 26.6/120: 22% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), draenic_agility_potion
0:04.019 ambush Fluffy_Pillow 49.2/120: 41% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion
0:06.044 ambush Fluffy_Pillow 46.5/120: 39% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, draenic_agility_potion
0:07.049 Waiting 0.973 sec 21.0/120: 18% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, draenic_agility_potion
0:08.022 eviscerate Fluffy_Pillow 43.1/120: 36% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, draenic_agility_potion
0:09.027 ambush Fluffy_Pillow 47.7/120: 40% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion
0:10.795 eviscerate Fluffy_Pillow 41.3/120: 34% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, draenic_agility_potion
0:11.799 ambush Fluffy_Pillow 45.8/120: 38% energy | 3.0/5: 60% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion
0:12.804 Waiting 0.500 sec 28.3/120: 24% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion
0:13.304 eviscerate Fluffy_Pillow 35.6/120: 30% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, draenic_agility_potion
0:14.308 backstab Fluffy_Pillow 48.1/120: 40% energy | 1.0/5: 20% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion
0:15.309 Waiting 0.600 sec 27.6/120: 23% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion
0:15.909 backstab Fluffy_Pillow 36.3/120: 30% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion
0:16.914 Waiting 0.800 sec 23.8/120: 20% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion
0:17.714 eviscerate Fluffy_Pillow 35.4/120: 30% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion
0:18.718 backstab Fluffy_Pillow 48.0/120: 40% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords, draenic_agility_potion
0:19.723 Waiting 0.300 sec 27.5/120: 23% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords, draenic_agility_potion
0:20.023 backstab Fluffy_Pillow 39.8/120: 33% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords
0:21.028 Waiting 2.287 sec 19.4/120: 16% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords
0:23.315 backstab Fluffy_Pillow 60.5/120: 50% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice
0:24.319 rupture Fluffy_Pillow 48.0/120: 40% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, anticipation
0:26.866 vanish Fluffy_Pillow 92.9/120: 77% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice
0:26.866 premeditation Fluffy_Pillow 92.9/120: 77% energy | 2.0/5: 40% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:26.866 ambush Fluffy_Pillow 92.9/120: 77% energy | 4.0/5: 80% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:28.381 ambush Fluffy_Pillow 62.8/120: 52% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(2)
0:29.384 Waiting 0.527 sec 17.4/120: 14% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(4)
0:29.911 preparation Fluffy_Pillow 25.0/120: 21% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(4)
0:30.917 slice_and_dice Fluffy_Pillow 47.5/120: 40% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:31.921 backstab Fluffy_Pillow 62.1/120: 52% energy | 0.0/5: 0% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:32.927 backstab Fluffy_Pillow 49.6/120: 41% energy | 2.0/5: 40% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:33.931 Waiting 0.100 sec 29.2/120: 24% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:34.031 backstab Fluffy_Pillow 38.6/120: 32% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:35.034 Waiting 0.973 sec 18.1/120: 15% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:36.007 eviscerate Fluffy_Pillow 40.2/120: 34% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, anticipation(5)
0:37.014 eviscerate Fluffy_Pillow 44.8/120: 37% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice
0:38.016 backstab Fluffy_Pillow 57.3/120: 48% energy | 1.0/5: 20% combo_points bloodlust, slice_and_dice
0:41.581 backstab Fluffy_Pillow 79.4/120: 66% energy | 4.0/5: 80% combo_points slice_and_dice
0:42.584 rupture Fluffy_Pillow 63.5/120: 53% energy | 5.0/5: 100% combo_points slice_and_dice
0:44.355 vanish Fluffy_Pillow 91.2/120: 76% energy | 1.0/5: 20% combo_points slice_and_dice
0:44.355 ambush Fluffy_Pillow 91.2/120: 76% energy | 1.0/5: 20% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:46.126 wait Fluffy_Pillow 59.0/120: 49% energy | 4.0/5: 80% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:47.126 premeditation Fluffy_Pillow 70.1/120: 58% energy | 4.0/5: 80% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:47.126 ambush Fluffy_Pillow 70.1/120: 58% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:48.131 Waiting 0.600 sec 29.3/120: 24% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(2)
0:48.731 eviscerate Fluffy_Pillow 36.0/120: 30% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(3)
0:49.735 backstab Fluffy_Pillow 37.2/120: 31% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice
0:50.740 Waiting 1.227 sec 21.3/120: 18% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
0:51.967 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
0:52.970 backstab Fluffy_Pillow 44.2/120: 37% energy | 1.0/5: 20% combo_points master_of_subtlety, slice_and_dice
0:53.975 Waiting 0.615 sec 20.4/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
0:54.590 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
0:55.594 Waiting 1.421 sec 11.4/120: 9% energy | 4.0/5: 80% combo_points slice_and_dice
0:57.015 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
0:58.019 Waiting 0.602 sec 19.4/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
0:58.621 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
0:59.625 Waiting 2.400 sec 37.3/120: 31% energy | 2.0/5: 40% combo_points slice_and_dice
1:02.025 shadow_dance Fluffy_Pillow 80.0/120: 67% energy | 3.0/5: 60% combo_points slice_and_dice
1:02.025 ambush Fluffy_Pillow 80.0/120: 67% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice
1:03.029 ambush Fluffy_Pillow 51.2/120: 43% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice
1:04.035 slice_and_dice Fluffy_Pillow 30.4/120: 25% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
1:05.040 ambush Fluffy_Pillow 41.6/120: 35% energy | 0.0/5: 0% combo_points shadow_dance, slice_and_dice, anticipation(3)
1:07.323 premeditation Fluffy_Pillow 35.0/120: 29% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, anticipation(3)
1:07.323 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
1:08.329 ambush Fluffy_Pillow 44.2/120: 37% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice
1:10.869 ambush Fluffy_Pillow 40.5/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(2)
1:11.873 Waiting 1.397 sec 11.7/120: 10% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(4)
1:13.270 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:14.276 eviscerate Fluffy_Pillow 44.4/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice
1:15.281 backstab Fluffy_Pillow 45.6/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice
1:16.285 Waiting 0.500 sec 29.8/120: 25% energy | 2.0/5: 40% combo_points slice_and_dice
1:16.785 backstab Fluffy_Pillow 35.4/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
1:17.789 Waiting 1.408 sec 11.5/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice
1:19.197 backstab Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
1:20.203 Waiting 0.600 sec 19.4/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:20.803 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:21.808 backstab Fluffy_Pillow 37.3/120: 31% energy | 2.0/5: 40% combo_points slice_and_dice
1:22.812 Waiting 1.216 sec 21.5/120: 18% energy | 3.0/5: 60% combo_points slice_and_dice
1:24.028 backstab Fluffy_Pillow 43.0/120: 36% energy | 4.0/5: 80% combo_points slice_and_dice
1:25.032 Waiting 1.021 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
1:26.053 eviscerate Fluffy_Pillow 38.6/120: 32% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:27.057 backstab Fluffy_Pillow 39.7/120: 33% energy | 1.0/5: 20% combo_points slice_and_dice
1:28.062 Waiting 1.000 sec 23.9/120: 20% energy | 3.0/5: 60% combo_points slice_and_dice
1:29.062 backstab Fluffy_Pillow 35.1/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
1:30.067 Waiting 0.615 sec 19.3/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
1:30.682 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice
1:31.686 backstab Fluffy_Pillow 37.3/120: 31% energy | 0.0/5: 0% combo_points slice_and_dice
1:32.690 Waiting 1.216 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice
1:33.906 backstab Fluffy_Pillow 35.0/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
1:34.910 Waiting 1.121 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
1:36.031 backstab Fluffy_Pillow 39.7/120: 33% energy | 4.0/5: 80% combo_points slice_and_dice
1:37.037 Waiting 0.919 sec 15.9/120: 13% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:37.956 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:38.960 backstab Fluffy_Pillow 45.3/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice, anticipation
1:39.965 Waiting 0.516 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
1:40.481 backstab Fluffy_Pillow 35.2/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice, anticipation
1:41.486 Waiting 1.419 sec 11.4/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
1:42.905 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:43.911 backstab Fluffy_Pillow 36.4/120: 30% energy | 1.0/5: 20% combo_points slice_and_dice
1:44.917 Waiting 1.093 sec 20.6/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice
1:46.010 backstab Fluffy_Pillow 40.8/120: 34% energy | 3.0/5: 60% combo_points slice_and_dice
1:47.012 Waiting 1.022 sec 17.0/120: 14% energy | 5.0/5: 100% combo_points slice_and_dice
1:48.034 eviscerate Fluffy_Pillow 36.3/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice
1:49.038 backstab Fluffy_Pillow 37.5/120: 31% energy | 1.0/5: 20% combo_points slice_and_dice
1:50.042 Waiting 1.197 sec 21.7/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice
1:51.239 backstab Fluffy_Pillow 35.0/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
1:52.244 Waiting 1.019 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
1:53.263 rupture Fluffy_Pillow 30.6/120: 25% energy | 5.0/5: 100% combo_points slice_and_dice
1:54.267 backstab Fluffy_Pillow 49.7/120: 41% energy | 0.0/5: 0% combo_points slice_and_dice
1:55.271 Waiting 0.800 sec 25.9/120: 22% energy | 1.0/5: 20% combo_points slice_and_dice
1:56.071 backstab Fluffy_Pillow 42.8/120: 36% energy | 2.0/5: 40% combo_points slice_and_dice
1:57.077 Waiting 0.936 sec 19.0/120: 16% energy | 3.0/5: 60% combo_points slice_and_dice
1:58.013 backstab Fluffy_Pillow 37.4/120: 31% energy | 4.0/5: 80% combo_points slice_and_dice
1:59.015 Waiting 1.223 sec 13.6/120: 11% energy | 5.0/5: 100% combo_points slice_and_dice
2:00.238 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:01.243 Waiting 0.800 sec 36.4/120: 30% energy | 1.0/5: 20% combo_points slice_and_dice
2:02.043 shadow_dance Fluffy_Pillow 53.3/120: 44% energy | 1.0/5: 20% combo_points slice_and_dice, spirit_of_the_warlords
2:02.043 shadow_reflection Fluffy_Pillow 53.3/120: 44% energy | 1.0/5: 20% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords
2:02.043 premeditation Fluffy_Pillow 53.3/120: 44% energy | 1.0/5: 20% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:02.043 ambush Fluffy_Pillow 53.3/120: 44% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:04.074 ambush Fluffy_Pillow 43.9/120: 37% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords
2:05.077 Waiting 1.088 sec 15.1/120: 13% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords
2:06.165 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords
2:07.684 ambush Fluffy_Pillow 42.1/120: 35% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:08.947 Waiting 0.100 sec 24.2/120: 20% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords
2:09.047 rupture Fluffy_Pillow 25.3/120: 21% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords
2:10.051 ambush Fluffy_Pillow 44.5/120: 37% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:12.078 eviscerate Fluffy_Pillow 35.1/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords
2:13.083 backstab Fluffy_Pillow 36.3/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:14.088 Waiting 1.308 sec 20.4/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:15.396 backstab Fluffy_Pillow 35.0/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:16.402 Waiting 0.619 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:17.021 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:18.024 backstab Fluffy_Pillow 45.3/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords
2:19.029 Waiting 1.017 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, spirit_of_the_warlords
2:20.046 backstab Fluffy_Pillow 40.8/120: 34% energy | 3.0/5: 60% combo_points slice_and_dice, spirit_of_the_warlords
2:21.050 Waiting 1.020 sec 17.0/120: 14% energy | 4.0/5: 80% combo_points slice_and_dice, spirit_of_the_warlords
2:22.070 eviscerate Fluffy_Pillow 36.3/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice
2:26.396 vanish Fluffy_Pillow 90.5/120: 75% energy | 2.0/5: 40% combo_points slice_and_dice
2:26.396 premeditation Fluffy_Pillow 90.5/120: 75% energy | 2.0/5: 40% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice
2:26.396 ambush Fluffy_Pillow 90.5/120: 75% energy | 4.0/5: 80% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice
2:28.169 wait Fluffy_Pillow 58.2/120: 49% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation
2:29.169 ambush Fluffy_Pillow 69.4/120: 58% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(2)
2:30.172 rupture Fluffy_Pillow 28.5/120: 24% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(4)
2:31.176 eviscerate Fluffy_Pillow 39.7/120: 33% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
2:32.179 backstab Fluffy_Pillow 48.9/120: 41% energy | 0.0/5: 0% combo_points master_of_subtlety, slice_and_dice
2:33.182 Waiting 0.900 sec 25.1/120: 21% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice
2:34.082 backstab Fluffy_Pillow 43.1/120: 36% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice
2:35.086 Waiting 0.914 sec 19.3/120: 16% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice
2:36.000 backstab Fluffy_Pillow 37.4/120: 31% energy | 4.0/5: 80% combo_points slice_and_dice
2:37.003 Waiting 1.222 sec 13.6/120: 11% energy | 5.0/5: 100% combo_points slice_and_dice
2:38.225 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:39.230 backstab Fluffy_Pillow 36.4/120: 30% energy | 1.0/5: 20% combo_points slice_and_dice
2:40.236 Waiting 1.293 sec 20.6/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice
2:41.529 backstab Fluffy_Pillow 35.0/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
2:42.532 Waiting 1.422 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
2:43.954 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
2:44.956 backstab Fluffy_Pillow 44.2/120: 37% energy | 1.0/5: 20% combo_points slice_and_dice
2:45.961 Waiting 0.616 sec 20.4/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
2:46.577 backstab Fluffy_Pillow 35.2/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
2:47.583 Waiting 1.219 sec 11.4/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice
2:48.802 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice
2:49.808 backstab Fluffy_Pillow 44.2/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice
2:50.812 Waiting 0.600 sec 28.4/120: 24% energy | 1.0/5: 20% combo_points slice_and_dice
2:51.412 backstab Fluffy_Pillow 35.1/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
2:52.416 Waiting 1.417 sec 19.2/120: 16% energy | 3.0/5: 60% combo_points slice_and_dice
2:53.833 backstab Fluffy_Pillow 35.0/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
2:54.837 Waiting 1.220 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
2:56.057 backstab Fluffy_Pillow 40.8/120: 34% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:57.059 Waiting 1.023 sec 16.9/120: 14% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
2:58.082 backstab Fluffy_Pillow 36.3/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(3)
2:59.087 Waiting 1.120 sec 12.5/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4)
3:00.207 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points anticipation(5)
3:01.214 Waiting 0.900 sec 44.2/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation(5)
3:02.114 shadow_dance Fluffy_Pillow 54.2/120: 45% energy | 1.0/5: 20% combo_points slice_and_dice, anticipation(5)
3:02.114 premeditation Fluffy_Pillow 54.2/120: 45% energy | 1.0/5: 20% combo_points shadow_dance, slice_and_dice, anticipation(5)
3:02.114 ambush Fluffy_Pillow 54.2/120: 45% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, anticipation(5)
3:03.118 Waiting 0.200 sec 33.4/120: 28% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(5)
3:03.318 eviscerate Fluffy_Pillow 35.6/120: 30% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(5)
3:04.324 ambush Fluffy_Pillow 44.8/120: 37% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation
3:05.330 Waiting 0.904 sec 16.0/120: 13% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
3:06.234 rupture Fluffy_Pillow 34.1/120: 28% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
3:07.238 ambush Fluffy_Pillow 45.3/120: 38% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice
3:09.776 ambush Fluffy_Pillow 41.5/120: 35% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(2)
3:10.781 Waiting 1.282 sec 20.7/120: 17% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(5)
3:12.063 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(5)
3:13.068 eviscerate Fluffy_Pillow 44.2/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:14.071 backstab Fluffy_Pillow 45.4/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice
3:15.075 Waiting 0.500 sec 29.6/120: 25% energy | 3.0/5: 60% combo_points slice_and_dice
3:15.575 backstab Fluffy_Pillow 35.1/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
3:16.580 Waiting 1.410 sec 19.3/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
3:17.990 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
3:18.993 backstab Fluffy_Pillow 44.2/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice
3:19.998 Waiting 0.615 sec 20.4/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
3:20.613 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
3:21.616 Waiting 1.422 sec 11.4/120: 9% energy | 4.0/5: 80% combo_points slice_and_dice
3:23.038 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
3:24.041 Waiting 1.421 sec 11.4/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:25.462 rupture Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:26.467 backstab Fluffy_Pillow 54.4/120: 45% energy | 2.0/5: 40% combo_points slice_and_dice
3:27.472 Waiting 0.400 sec 30.6/120: 25% energy | 3.0/5: 60% combo_points slice_and_dice
3:27.872 backstab Fluffy_Pillow 35.1/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
3:28.878 Waiting 0.615 sec 19.3/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
3:29.493 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice
3:30.497 backstab Fluffy_Pillow 45.3/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice
3:31.501 Waiting 0.717 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice
3:32.218 backstab Fluffy_Pillow 37.4/120: 31% energy | 3.0/5: 60% combo_points slice_and_dice
3:33.222 Waiting 1.221 sec 13.6/120: 11% energy | 4.0/5: 80% combo_points slice_and_dice
3:34.443 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
3:35.445 Waiting 1.423 sec 11.4/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:36.868 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
3:37.874 backstab Fluffy_Pillow 36.4/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice
3:38.876 Waiting 1.296 sec 20.6/120: 17% energy | 4.0/5: 80% combo_points slice_and_dice
3:40.172 backstab Fluffy_Pillow 35.0/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
3:41.177 Waiting 1.120 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
3:42.297 eviscerate Fluffy_Pillow 39.7/120: 33% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:43.301 backstab Fluffy_Pillow 40.9/120: 34% energy | 1.0/5: 20% combo_points slice_and_dice
3:44.307 Waiting 0.900 sec 25.1/120: 21% energy | 3.0/5: 60% combo_points slice_and_dice
3:45.207 backstab Fluffy_Pillow 35.1/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
3:46.211 Waiting 0.615 sec 19.3/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
3:46.826 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice
3:47.830 backstab Fluffy_Pillow 37.3/120: 31% energy | 0.0/5: 0% combo_points slice_and_dice
3:48.835 Waiting 1.216 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice
3:50.051 backstab Fluffy_Pillow 35.0/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
3:51.056 Waiting 1.219 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
3:52.275 backstab Fluffy_Pillow 40.8/120: 34% energy | 4.0/5: 80% combo_points slice_and_dice
3:53.280 Waiting 1.020 sec 17.0/120: 14% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:54.300 eviscerate Fluffy_Pillow 36.3/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:55.305 Waiting 1.100 sec 37.5/120: 31% energy | 2.0/5: 40% combo_points slice_and_dice
3:58.704 vanish Fluffy_Pillow 91.4/120: 76% energy | 3.0/5: 60% combo_points slice_and_dice, spirit_of_the_warlords
3:58.704 premeditation Fluffy_Pillow 91.4/120: 76% energy | 3.0/5: 60% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, spirit_of_the_warlords
3:58.704 ambush Fluffy_Pillow 91.4/120: 76% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, spirit_of_the_warlords
3:59.708 eviscerate Fluffy_Pillow 42.6/120: 35% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(3), spirit_of_the_warlords
4:01.482 ambush Fluffy_Pillow 60.3/120: 50% energy | 4.0/5: 80% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, spirit_of_the_warlords
4:02.487 Waiting 0.594 sec 19.5/120: 16% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords
4:03.081 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords
4:04.087 backstab Fluffy_Pillow 37.3/120: 31% energy | 1.0/5: 20% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords
4:05.092 Waiting 1.213 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords
4:06.305 backstab Fluffy_Pillow 43.0/120: 36% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords
4:07.309 Waiting 0.921 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords
4:08.230 backstab Fluffy_Pillow 37.4/120: 31% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, spirit_of_the_warlords
4:09.235 Waiting 1.020 sec 13.6/120: 11% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2), spirit_of_the_warlords
4:10.255 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2), spirit_of_the_warlords
4:11.259 backstab Fluffy_Pillow 44.2/120: 37% energy | 3.0/5: 60% combo_points slice_and_dice, spirit_of_the_warlords
4:14.312 shadow_dance Fluffy_Pillow 59.2/120: 49% energy | 5.0/5: 100% combo_points slice_and_dice, spirit_of_the_warlords
4:14.312 shadow_reflection Fluffy_Pillow 59.2/120: 49% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords
4:14.312 ambush Fluffy_Pillow 59.2/120: 49% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords
4:15.316 Waiting 0.500 sec 30.4/120: 25% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords
4:15.816 eviscerate Fluffy_Pillow 35.9/120: 30% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords
4:16.821 ambush Fluffy_Pillow 45.1/120: 38% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords
4:19.360 ambush Fluffy_Pillow 41.4/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(2)
4:20.366 Waiting 1.296 sec 20.6/120: 17% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4)
4:21.662 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(5)
4:22.666 ambush Fluffy_Pillow 44.2/120: 37% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection
4:23.671 Waiting 1.063 sec 15.4/120: 13% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3)
4:24.734 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation(3)
4:25.739 backstab Fluffy_Pillow 36.4/120: 30% energy | 4.0/5: 80% combo_points slice_and_dice, shadow_reflection
4:26.744 Waiting 0.494 sec 20.6/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection
4:27.238 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection
4:28.243 backstab Fluffy_Pillow 45.3/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice, shadow_reflection
4:29.248 Waiting 1.015 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, shadow_reflection
4:30.263 backstab Fluffy_Pillow 40.8/120: 34% energy | 3.0/5: 60% combo_points slice_and_dice, shadow_reflection
4:31.268 Waiting 1.020 sec 17.0/120: 14% energy | 4.0/5: 80% combo_points slice_and_dice
4:32.288 eviscerate Fluffy_Pillow 36.3/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice
4:33.294 backstab Fluffy_Pillow 37.5/120: 31% energy | 0.0/5: 0% combo_points slice_and_dice
4:34.299 Waiting 1.193 sec 21.7/120: 18% energy | 1.0/5: 20% combo_points slice_and_dice
4:35.492 backstab Fluffy_Pillow 35.0/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
4:36.498 Waiting 1.419 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
4:37.917 backstab Fluffy_Pillow 35.0/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
4:38.920 Waiting 0.621 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:39.541 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:40.545 backstab Fluffy_Pillow 45.3/120: 38% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation
4:41.553 Waiting 0.713 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
4:42.266 backstab Fluffy_Pillow 37.4/120: 31% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
4:43.271 Waiting 1.220 sec 13.6/120: 11% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
4:44.491 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
4:45.495 Waiting 1.221 sec 11.4/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
4:46.716 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
4:47.721 backstab Fluffy_Pillow 44.2/120: 37% energy | 3.0/5: 60% combo_points slice_and_dice
4:48.727 Waiting 0.600 sec 28.4/120: 24% energy | 4.0/5: 80% combo_points slice_and_dice
4:49.327 backstab Fluffy_Pillow 35.1/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
4:50.330 Waiting 1.417 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:51.747 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:52.751 backstab Fluffy_Pillow 44.2/120: 37% energy | 2.0/5: 40% combo_points slice_and_dice
4:53.755 Waiting 0.614 sec 20.4/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice
4:54.369 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
4:55.373 Waiting 1.421 sec 11.4/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice
4:56.794 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:57.800 backstab Fluffy_Pillow 36.4/120: 30% energy | 1.0/5: 20% combo_points slice_and_dice

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 1271 1211 1211
Agility 4985 4447 3747 (1552)
Stamina 4372 3975 3975
Intellect 745 710 710
Spirit 532 532 532
Health 262320 238500 0
Energy 120 120 0
Combo Points 5 5 0
Crit 25.70% 20.70% 627
Haste 11.35% 6.05% 605
Multistrike 19.26% 12.67% 836
Damage / Heal Versatility 5.72% 2.72% 354
Attack Power 5484 4447 0
Mastery 58.68% 43.68% 722
Armor 923 923 923

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Cloak and Dagger Shadowstep Burst of Speed
75 Prey on the Weak Internal Bleeding Dirty Tricks
90 Shuriken Toss Marked for Death Anticipation
100 Venom Rush Shadow Reflection Death from Above

Profile

rogue="Mîrai"
origin="http://eu.battle.net/wow/en/character/forscherliga/Mîrai/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/98/74316130-avatar.jpg"
level=100
race=dwarf
role=attack
position=back
professions=jewelcrafting=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#cb!1101021
glyphs=hemorrhaging_veins/cloak_of_shadows/energy/poisons/safe_fall
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/apply_poison,lethal=deadly
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/stealth
actions.precombat+=/slice_and_dice
# Proxy Honor Among Thieves action. Generates Combo Points at a mean rate of 2.2 seconds. Comment out to disable (and use the real Honor Among Thieves).
actions.precombat+=/honor_among_thieves,cooldown=2.2,cooldown_stddev=0.1

# Executed every time the actor is available.

actions=potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|buff.shadow_dance.up&(trinket.proc.agi.react|trinket.proc.multistrike.react|trinket.stacking_proc.agi.react|trinket.stacking_proc.multistrike.react|buff.archmages_greater_incandescence_agi.react)
actions+=/kick
actions+=/shadow_reflection,if=buff.shadow_dance.up
actions+=/blood_fury,if=buff.shadow_dance.up
actions+=/berserking,if=buff.shadow_dance.up
actions+=/arcane_torrent,if=energy<60&buff.shadow_dance.up
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die&combo_points=((target.time_to_die-buff.slice_and_dice.remains)%6)+1
actions+=/premeditation,if=combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
actions+=/pool_resource,for_next=1
actions+=/garrote,if=!ticking&time<1
actions+=/wait,sec=1,if=buff.subterfuge.remains>1.1&buff.subterfuge.remains<1.3&time>6
actions+=/pool_resource,for_next=1
actions+=/ambush,if=combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
actions+=/pool_resource,for_next=1,extra_amount=50
actions+=/shadow_dance,if=energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
actions+=/pool_resource,for_next=1,extra_amount=50
actions+=/vanish,if=talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
actions+=/pool_resource,for_next=1,extra_amount=90
actions+=/vanish,if=talent.subterfuge.enabled&energy>=90&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
actions+=/marked_for_death,if=combo_points=0
actions+=/run_action_list,name=generator,if=talent.anticipation.enabled&anticipation_charges<4&buff.slice_and_dice.up&dot.rupture.remains>2&(buff.slice_and_dice.remains<6|dot.rupture.remains<4)
actions+=/run_action_list,name=finisher,if=combo_points=5
actions+=/run_action_list,name=generator,if=combo_points<4|(combo_points=4&cooldown.honor_among_thieves.remains>1&energy>70-energy.regen)|talent.anticipation.enabled
actions+=/run_action_list,name=pool

# Combo point generators

actions.generator=run_action_list,name=pool,if=buff.master_of_subtlety.down&buff.shadow_dance.down&debuff.find_weakness.down&(energy+cooldown.shadow_dance.remains*energy.regen<80|energy+cooldown.vanish.remains*energy.regen<60)
actions.generator+=/fan_of_knives,if=active_enemies>1
actions.generator+=/shuriken_toss,if=energy<65&energy.regen<16
actions.generator+=/backstab
actions.generator+=/hemorrhage,if=position_front
actions.generator+=/run_action_list,name=pool

# Combo point finishers

actions.finisher=rupture,cycle_targets=1,if=(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die
actions.finisher+=/death_from_above
actions.finisher+=/crimson_tempest,if=(active_enemies>=3&dot.crimson_tempest_dot.ticks_remain<=2&combo_points=5)|active_enemies>=5&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/eviscerate,if=active_enemies<4|(active_enemies>3&dot.crimson_tempest_dot.ticks_remain>=2)&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/run_action_list,name=pool

# Resource pooling

actions.pool=preparation,if=!buff.vanish.up&cooldown.vanish.remains>60

head=runeenscribed_hood,id=113845
neck=shifting_taladite_pendant,id=115800,bonus_id=136/527/539,enchant=75mult
shoulders=studded_frostboar_leather_spaulders,id=118890
back=cloak_of_creeping_necrosis,id=113657,enchant=100mult
chest=chestguard_of_determined_resolve,id=114497,bonus_id=52
wrists=railwalker_bindings,id=118955,bonus_id=20
hands=throatripper_gauntlets,id=113602
waist=waistgirdle_of_the_mountain,id=118886
legs=nether_blast_leggings,id=113856
feet=sandals_of_mycoid_musing,id=113664
finger1=timeless_solium_band_of_the_assassin,id=118297,enchant=30mult
finger2=shifting_taladite_ring,id=115796,bonus_id=181/527/540,enchant=50mult
trinket1=skull_of_war,id=112318,bonus_id=525/529
trinket2=bloodmaws_tooth,id=116289
main_hand=miniature_winter_veil_tree,id=117371,bonus_id=553,enchant=mark_of_the_shattered_hand
off_hand=felshanker,id=118738,bonus_id=524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_agility=2403
# gear_stamina=3084
# gear_crit_rating=627
# gear_haste_rating=605
# gear_mastery_rating=722
# gear_armor=923
# gear_multistrike_rating=796
# gear_versatility_rating=354

Shaerlyn

Shaerlyn : 26470 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
26470.3 26470.3 10.5 / 0.040% 3260.0 / 12.3% 65.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
380.8 380.8 Mana 0.00% 43.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Shaerlyn/advanced
Talents
  • 15: Stone Bulwark Totem
  • 30: Windwalk Totem
  • 45: Totemic Projection
  • 60: Elemental Mastery
  • 75: Ancestral Guidance
  • 90: Unleashed Fury
  • 100: Elemental Fusion
  • Talent Calculator
Glyphs
  • Glyph of Chain Lightning
  • Glyph of Lightning Shield
  • Glyph of Spiritwalker's Focus
  • Glyph of the Lakestrider
  • Glyph of Astral Recall
  • Glyph of Ghostly Speed
Professions
  • jewelcrafting: 710
  • enchanting: 700

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Shaerlyn+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x150&chd=t:48018|36831|35504|12201&chds=0,96035&chco=ABD473,C41F3B,C41F3B,ABD473&chm=t++48018++earth_shock,ABD473,0,0,15|t++36831++flame_shock,C41F3B,1,0,15|t++35504++lava_burst,C41F3B,2,0,15|t++12201++lightning_bolt,ABD473,3,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Shaerlyn+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:39,26,16,9,7,3,3,3,0&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,C41F3B,ABD473,C41F3B,ABD473,C41F3B,C41F3B,C41F3B&chl=lava_burst|lightning_bolt|molten_earth|fulmination|flame_shock|earth_shock|searing_totem: searing_bolt|greater_fire_elemental: melee|greater_fire_elemental: fire_blast&
http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Shaerlyn+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Ybeimqtwy25678530ywwvtsoljhfebaaabbbbbaZYYXYXXWWWWVVUUTTTTTTSTSSTTTUUUUUUUUUTTTTUUUUUUUTUTTTTTTTTUUUUUUUUUUTTTTUUVVWWWXXYYYZZabcddeeeeedcbaaaZZYYXXWWVUUTTTTTUUUUUUUUTUTTTTTTTTTTUVVWXYYZaabbcddeeefedcccbaaZZYXWWVUUUUUVVVVVVUUUTUTTUUUUUVVVWWWXXYZaabcddeeeeddccbaaaZZYXXWVUUTTTTTTTUUUUUUUTTTTTTTTTTTTTTTTTTTTTTTUUUUUVUUUUUUUUUUUUUUUUUUUUUUVVVVUUUUUUUUUUUUUTTTUUVVWWYZYXWVUSSRQP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.419091,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=26470|max=63161&chxp=1,1,42,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Shaerlyn+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,2,2,5,9,23,46,81,128,195,290,393,503,651,810,983,1101,1191,1362,1319,1463,1383,1436,1384,1365,1300,1183,1110,986,846,736,639,503,404,304,267,181,119,100,57,55,43,19,6,5,4,4,1,0,2&chds=0,1463&chbh=5&chxt=x&chxl=0:|min=23557|avg=26470|max=30002&chxp=0,1,45,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Shaerlyn+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:52.1,27.4,7.5,6.5,4.5,1.3,0.5&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,C41F3B,ABD473,C41F3B,C41F3B,C41F3B&chl=lightning_bolt 156.9s|lava_burst 82.5s|unleash_flame 22.6s|earth_shock 19.7s|flame_shock 13.5s|searing_totem 3.9s|fire_elemental_totem 1.5s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Shaerlyn 26470
earth_shock 848 (3147) 3.2% (11.9%) 16.1 18.36sec 58902 48018 Direct 16.1 9592 23967 11752 15.0% 13.9 3883 9715 15.0%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.05 16.05 0.00 0.00 1.2267 0.0000 254906.62 254906.62 0.00 48017.56 48017.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.09 15.04% 9715.37 5663 14485 8561.26 0 14485 20333 20333 0.00
multistrike 11.82 84.96% 3882.55 2265 5794 3886.45 0 5365 45903 45903 0.00
hit 13.64 84.97% 9591.68 5593 14307 9600.29 7771 11278 130852 130852 0.00
crit 2.41 15.03% 23966.55 13982 35766 22147.96 0 35766 57818 57818 0.00
 
DPS Timeline Chart
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing {$s1=1119} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.925000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    fulmination 2299 8.7% 16.1 18.36sec 43025 0 Direct 16.1 25926 64858 31825 15.2% 14.0 10500 26273 15.1%  

Stats details: fulmination

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.05 16.05 0.00 0.00 0.0000 0.0000 690751.22 690751.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.11 15.08% 26272.84 20777 37403 23226.91 0 37403 55321 55321 0.00
multistrike 11.86 84.92% 10499.71 8311 14961 10513.45 0 13128 124493 124493 0.00
hit 13.62 84.85% 25925.51 20520 36941 25961.18 22856 29764 353159 353159 0.00
crit 2.43 15.15% 64858.22 51301 92353 60036.23 0 92353 157779 157779 0.00
 
DPS Timeline Chart
 

Action details: fulmination

Static Values
  • id:88766
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:26364
  • name:Lightning Shield
  • school:nature
  • tooltip:
  • description:Discharges lightning at an attacker, dealing {$s1=274} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.226305
  • base_dd_min:0.00
  • base_dd_max:0.00
 
flame_shock 1651 6.2% 10.7 29.18sec 46138 36831 Direct 10.7 4017 10021 4918 15.0% 9.2 1623 4049 15.1%  
Periodic 124.7 2049 5123 2514 15.1% 108.8 830 2076 15.1% 98.9%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.74 10.74 124.73 124.73 1.2527 2.3866 495491.59 495491.59 0.00 1592.49 36831.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.40 15.14% 4049.36 2143 6540 3074.09 0 6540 5649 5649 0.00
multistrike 7.82 84.86% 1623.43 857 2616 1625.27 0 2616 12697 12697 0.00
hit 9.13 85.00% 4017.32 2117 6459 4025.00 2794 5254 36673 36673 0.00
crit 1.61 15.00% 10020.54 5292 16147 8234.10 0 16147 16141 16141 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.4 15.11% 2076.19 1072 3271 2080.16 1381 2803 34112 34112 0.00
multistrike 92.3 84.89% 830.08 429 1308 831.66 608 1098 76641 76641 0.00
hit 105.8 84.86% 2048.61 2 3231 2052.38 1548 2645 216845 216845 0.00
crit 18.9 15.14% 5122.69 10 8077 5133.18 3323 7198 96734 96734 0.00
 
DPS Timeline Chart
 

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains<=9
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=424} Fire damage and then an additional $o1 Fire damage over {$d=30 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
lava_burst 9795 36.9% 60.5 4.91sec 48378 35504 Direct 60.4 0 33978 33978 100.0% 63.5 0 13786 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.55 60.44 0.00 0.00 1.3626 0.0000 2929100.70 2929100.70 0.00 35503.82 35503.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 63.51 100.00% 13785.92 10500 19580 13794.54 12590 15117 875542 875542 0.00
crit 60.44 100.00% 33977.94 25927 48346 33998.20 32017 36062 2053558 2053558 0.00
 
DPS Timeline Chart
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:160.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=932} Fire damage. Lava Burst will always deal a critical strike. If your Flame Shock is on the target, Lava Burst will deal $8050m3% additional damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.770000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
lightning_bolt 6351 24.1% 95.9 2.91sec 19953 12201 Direct 95.6 12104 30251 14855 15.2% 82.1 4902 12259 15.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.94 95.64 0.00 0.00 1.6354 0.0000 1914237.04 1914237.04 0.00 12200.91 12200.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.39 15.10% 12258.69 10074 15858 12261.42 10074 14935 151892 151892 0.00
multistrike 69.68 84.90% 4902.07 4030 6343 4903.42 4518 5298 341552 341552 0.00
hit 81.14 84.84% 12104.19 9950 15662 12107.14 11561 12698 982152 982152 0.00
crit 14.50 15.16% 30250.93 24874 39155 30259.84 24874 36873 438642 438642 0.00
 
DPS Timeline Chart
 

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:560.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Fires a bolt of lightning at the target, dealing {$s1=1065} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.880000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
molten_earth 4027 15.2% 125.4 2.38sec 9644 0 Direct 124.9 5841 14605 7166 15.1% 108.1 2369 5921 15.1%  

Stats details: molten_earth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.43 124.95 0.00 0.00 0.0000 0.0000 1209633.17 1209633.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.34 15.11% 5921.16 5445 7739 5926.01 5445 7165 96754 96754 0.00
multistrike 91.81 84.89% 2369.01 2178 3096 2370.96 2242 2539 217495 217495 0.00
hit 106.06 84.89% 5841.45 5378 7643 5846.09 5643 6159 619561 619561 0.00
crit 18.89 15.11% 14605.29 13445 19108 14616.71 13445 17221 275824 275824 0.00
 
DPS Timeline Chart
 

Action details: molten_earth

Static Values
  • id:170379
  • school:fire
  • resource:none
  • range:45.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:170379
  • name:Molten Earth
  • school:fire
  • tooltip:
  • description:{$@spelldesc170374=Your damaging spells incite the earth around you to come to your aid for {$170377d=6 seconds}, repeatedly dealing ${($m1/100)*($170379m1+{$170379m2=0})/2} Fire damage to your most recently attacked target. Also increases the damage of your Earthquake by {$s3=0}%.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_fire_elemental 2778 / 692
fire_blast 197 0.2% 12.7 15.59sec 1182 0 Direct 12.7 763 1909 937 15.2% 11.1 230 574 15.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.71 12.71 0.00 0.00 0.0000 0.0000 15022.14 15022.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.66 15.05% 574.34 520 739 462.06 0 739 956 956 0.00
multistrike 9.40 84.95% 229.68 208 296 231.18 208 296 2158 2158 0.00
hit 10.78 84.80% 762.53 694 986 767.20 694 869 8220 8220 0.00
crit 1.93 15.20% 1908.83 1734 2465 1645.98 0 2465 3688 3688 0.00
 
DPS Timeline Chart
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.459030
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 2581 2.4% 73.4 2.56sec 2650 2708 Direct 73.4 1711 4276 2100 15.2% 63.9 515 1287 15.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.37 73.37 0.00 0.00 0.9786 0.0000 194429.25 194429.25 0.00 2708.00 2708.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.68 15.14% 1286.87 1133 1611 1293.43 0 1611 12455 12455 0.00
multistrike 54.23 84.86% 514.87 453 644 517.55 466 576 27922 27922 0.00
hit 62.25 84.84% 1710.90 1511 2148 1719.75 1609 1816 106496 106496 0.00
crit 11.12 15.16% 4276.26 3778 5370 4298.21 0 5370 47556 47556 0.00
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - searing_totem 1165 / 805
searing_bolt 1165 3.0% 122.4 1.83sec 1971 0 Direct 122.1 1280 3199 1570 15.1% 105.4 384 960 15.1%  

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.38 122.07 0.00 0.00 0.0000 0.0000 241273.91 241273.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 15.94 15.13% 959.72 908 1099 959.32 908 1081 15301 15301 0.00
multistrike 89.43 84.87% 383.87 363 440 383.72 367 401 34331 34331 0.00
hit 103.60 84.87% 1279.57 1210 1465 1279.09 1238 1316 132559 132559 0.00
crit 18.47 15.13% 3198.69 3025 3663 3197.40 3025 3503 59083 59083 0.00
 
DPS Timeline Chart
 

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Shaerlyn
ascendance 2.0 181.25sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.02 2.02 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.72 84.90% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.31 15.10% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: ascendance

Static Values
  • id:165339
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:1664.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:active_enemies>1|(dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=60)&cooldown.lava_burst.remains>0)
Spelldata
  • id:165339
  • name:Ascendance
  • school:physical
  • tooltip:
  • description:The Shaman transforms into a Flame Ascendant for {$114051d=15 seconds}. While in this form, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam.
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
elemental_mastery 3.0 121.12sec

Stats details: elemental_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:action.lava_burst.cast_time>=1.2
Spelldata
  • id:16166
  • name:Elemental Mastery
  • school:nature
  • tooltip:Haste increased by {$s1=30}%.
  • description:Elemental forces empower you with {$s1=30}% haste for {$d=20 seconds}.
 
fire_elemental_totem 1.5 0.00sec

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.49 1.49 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:8607.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$s1=1} health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts {$d=60 seconds}.
 
lightning_shield 1.0 0.00sec

Stats details: lightning_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.85 84.73% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.15 15.27% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: lightning_shield

Static Values
  • id:324
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.lightning_shield.up
Spelldata
  • id:324
  • name:Lightning Shield
  • school:nature
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When an attack hits the caster, the attacker will be struck for {$26364s1=274} Nature damage. This effect may only occur once every few seconds. Lasts {$d=3600 seconds}.
 
searing_totem 3.9 66.11sec

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.87 3.87 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
Spelldata
  • id:3599
  • name:Searing Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$?s63298=false}[{$s1=5}% of the caster's][{$s1=5}] health at the feet of the caster for {$d=60 seconds} that repeatedly attacks an enemy within $3606r1 yards for {$3606s1=243} Fire damage.
 
unleash_flame 18.3 16.85sec

Stats details: unleash_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.31 18.31 0.00 0.00 1.2351 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: unleash_flame

Static Values
  • id:165462
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:165462
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes elemental forces of Flame, increasing the damage dealt by the Shaman's next Fire spell by {$s2=40}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
ascendance 2.0 0.0 181.2sec 181.2sec 10.16% 10.17% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ascendance_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 32.89% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 185.5sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
elemental_fusion 23.0 37.4 13.1sec 4.9sec 57.46% 83.77% 23.0(23.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_elemental_fusion
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • elemental_fusion_1:32.89%
  • elemental_fusion_2:24.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157174
  • name:Elemental Fusion
  • tooltip:Damage of your next Shock increased by $w1%.
  • description:{$@spelldesc152257=Your Lava Burst and Lava Lash increase the damage of your next Shock by {$157174s1=40}%, stacking up to 2 times.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_mastery 3.0 0.0 121.1sec 121.1sec 19.22% 40.92% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_elemental_mastery
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • elemental_mastery_1:19.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:16166
  • name:Elemental Mastery
  • tooltip:Haste increased by {$s1=30}%.
  • description:Elemental forces empower you with {$s1=30}% haste for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
enhanced_unleash 18.3 0.0 16.8sec 16.8sec 24.18% 24.19% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_enhanced_unleash
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_unleash_1:24.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162557
  • name:Enhanced Unleash
  • tooltip:Movement speed increased by {$s1=30}%.
  • description:{$@spelldesc157784=Your {$?s165462=true}[Unleash Flame]?s73685[Unleash Life][Unleash Elements] ability also causes you to gain {$162557s1=30}% increased movement speed for {$162557d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lava_surge 24.8 0.2 11.8sec 11.7sec 10.28% 43.82% 0.2(0.2)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lava_surge_1:10.28%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77756
  • name:Lava Surge
  • tooltip:
  • description:Your Flame Shock damage over time has a chance to reset the cooldown of your Lava Burst spell and cause your next Lava Burst spell to be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
mark_of_the_frostwolf 13.5 4.1 22.8sec 17.2sec 30.98% 31.00% 1.0(1.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_mark_of_the_frostwolf
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:500.00

Stack Uptimes

  • mark_of_the_frostwolf_1:23.71%
  • mark_of_the_frostwolf_2:7.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159676
  • name:Mark of the Frostwolf
  • tooltip:Multistrike increased by $w1.
  • description:Increases multistrike by {$s1=500}.
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
sudden_clarity 3.0 0.0 120.8sec 120.8sec 19.28% 19.29% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_sudden_clarity
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:spell_power
  • amount:1100.00

Stack Uptimes

  • sudden_clarity_1:19.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177594
  • name:Sudden Clarity
  • tooltip:Increases spellpower by {$s1=653}.
  • description:Increases your spellpower by {$s1=653} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
unleash_flame 18.3 0.0 16.8sec 16.8sec 25.72% 25.23% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_unleash_flame
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • unleash_flame_1:25.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:73683
  • name:Unleash Flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, increasing the damage dealt by the Shaman's next Fire spell by {$s2=40}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
unleashed_fury 18.3 0.0 16.8sec 16.8sec 59.82% 63.49% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_unleashed_fury
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • unleashed_fury_1:59.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118470
  • name:Unleashed Fury
  • tooltip:Increases damage dealt by Lightning Bolt by {$s1=30}% and Lava Burst by {$s2=10}%.
  • description:Increases the damage dealt by your Lightning Bolt by {$s1=30}% and Lava Burst by {$s2=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
lightning_shield

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_lightning_shield
  • max_stacks:20
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lightning_shield_1:10.85%
  • lightning_shield_2:3.90%
  • lightning_shield_3:6.99%
  • lightning_shield_4:5.72%
  • lightning_shield_5:4.91%
  • lightning_shield_6:5.15%
  • lightning_shield_7:5.13%
  • lightning_shield_8:5.23%
  • lightning_shield_9:5.25%
  • lightning_shield_10:5.26%
  • lightning_shield_11:5.20%
  • lightning_shield_12:5.17%
  • lightning_shield_13:5.10%
  • lightning_shield_14:5.06%
  • lightning_shield_15:5.03%
  • lightning_shield_16:4.19%
  • lightning_shield_17:3.59%
  • lightning_shield_18:2.73%
  • lightning_shield_19:2.05%
  • lightning_shield_20:3.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:324
  • name:Lightning Shield
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When an attack hits the caster, the attacker will be struck for {$26364s1=274} Nature damage. This effect may only occur once every few seconds. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Shaerlyn
ascendance Mana 2.0 3368.3 1664.0 1664.0 0.0
earth_shock Mana 16.1 6421.9 400.0 400.0 147.3
fire_elemental_totem Mana 1.5 12864.4 8607.0 8606.5 0.0
flame_shock Mana 10.7 4295.8 400.0 400.0 115.3
lava_burst Mana 60.5 9687.4 160.0 160.0 302.4
lightning_bolt Mana 95.9 53725.7 560.0 560.0 35.6
searing_totem Mana 3.9 3717.6 960.0 960.0 0.0
unleash_flame Mana 18.3 20505.4 1120.0 1120.0 0.0
Resource Gains Type Count Total Average Overflow
external_healing Health 8.74 0.00 (0.00%) 0.00 80825.29 100.00%
mp5_regen Mana 206.63 114099.51 (100.00%) 552.19 250871.75 68.74%
Resource RPS-Gain RPS-Loss
Mana 379.19 380.81
Combat End Resource Mean Min Max
Mana 159537.37 151393.00 160000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 65.5%
primal_fire_elemental-Mana Cap 65.5%
greater_fire_elemental-Mana Cap 65.5%
primal_storm_elemental-Mana Cap 65.5%
greater_storm_elemental-Mana Cap 65.5%
primal_earth_elemental-Mana Cap 65.5%
greater_earth_elemental-Mana Cap 65.5%
lightning_elemental-Mana Cap 65.5%
earth_elemental_totem-Mana Cap 65.5%
fire_elemental_totem-Mana Cap 65.5%
storm_elemental_totem-Mana Cap 65.5%
magma_totem-Mana Cap 65.5%
searing_totem-Mana Cap 65.5%

Procs

Count Interval
Elemental Fusion: Earth Shock 16.1 18.4sec
Elemental Fusion: Flame Shock 10.7 29.2sec
lava_surge 24.9 11.7sec
uf_flame_shock 5.4 53.8sec
uf_lava_burst 12.6 21.9sec
wasted_lava_surge 0.2 71.2sec
wasted_lightning_shield 11.9 36.7sec
lava_surge_during_lvb 5.0 50.4sec
Fulmination: 15 stacks 2.4 69.5sec
Fulmination: 16 stacks 2.5 68.9sec
Fulmination: 17 stacks 2.2 72.7sec
Fulmination: 18 stacks 1.8 78.5sec
Fulmination: 19 stacks 7.1 41.2sec
Fulmination: Generate 301.7 1.9sec

Statistics & Data Analysis

Fight Length
Sample Data Shaerlyn Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Shaerlyn Damage Per Second
Count 25000
Mean 26470.30
Minimum 23556.72
Maximum 30001.76
Spread ( max - min ) 6445.04
Range [ ( max - min ) / 2 * 100% ] 12.17%
Standard Deviation 850.4281
5th Percentile 25123.46
95th Percentile 27909.34
( 95th Percentile - 5th Percentile ) 2785.89
Mean Distribution
Standard Deviation 5.3786
95.00% Confidence Intervall ( 26459.75 - 26480.84 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3965
0.1 Scale Factor Error with Delta=300 6173
0.05 Scale Factor Error with Delta=300 24695
0.01 Scale Factor Error with Delta=300 617388
Distribution Chart
DPS(e)
Sample Data Shaerlyn Damage Per Second (Effective)
Count 25000
Mean 26470.30
Minimum 23556.72
Maximum 30001.76
Spread ( max - min ) 6445.04
Range [ ( max - min ) / 2 * 100% ] 12.17%
Damage
Sample Data Shaerlyn Damage
Count 25000
Mean 7494120.34
Minimum 5506236.74
Maximum 9474593.71
Spread ( max - min ) 3968356.96
Range [ ( max - min ) / 2 * 100% ] 26.48%
DTPS
Sample Data Shaerlyn Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaerlyn Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Shaerlyn Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaerlyn Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaerlyn Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaerlyn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ShaerlynTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Shaerlyn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 lightning_shield,if=!buff.lightning_shield.up
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_intellect
Default action list Executed every time the actor is available.
# count action,conditions
5 0.00 wind_shear
6 0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 3.01 use_item,name=copelands_clarity
8 1.00 potion,name=draenic_intellect,if=buff.ascendance.up|target.time_to_die<=30
In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
9 0.00 berserking,if=!buff.bloodlust.up&!buff.elemental_mastery.up&(set_bonus.tier15_4pc_caster=1|(buff.ascendance.cooldown_remains=0&(dot.flame_shock.remains>buff.ascendance.duration|level<87)))
A 0.00 blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
B 0.00 arcane_torrent
C 2.99 elemental_mastery,if=action.lava_burst.cast_time>=1.2
D 0.00 ancestral_swiftness,if=!buff.ascendance.up
E 0.00 storm_elemental_totem
F 1.49 fire_elemental_totem,if=!active
G 2.02 ascendance,if=active_enemies>1|(dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=60)&cooldown.lava_burst.remains>0)
H 0.00 liquid_magma,if=pet.searing_totem.remains>=15|pet.fire_elemental_totem.remains>=15
I 0.00 call_action_list,name=single,if=active_enemies=1
If only one enemy, priority follows the 'single' action list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On multiple enemies, the priority follows the 'aoe' action list.
actions.single Single target action priority list
# count action,conditions
K 0.00 unleash_flame,moving=1
L 0.00 spiritwalkers_grace,moving=1,if=buff.ascendance.up
M 5.03 earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
N 60.66 lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
O 18.31 unleash_flame,if=talent.unleashed_fury.enabled&!buff.ascendance.up
P 10.13 flame_shock,if=dot.flame_shock.remains<=9
Q 11.02 earth_shock,if=(set_bonus.tier17_4pc&buff.lightning_shield.react>=15&!buff.lava_surge.up)|(!set_bonus.tier17_4pc&buff.lightning_shield.react>15)
R 0.00 earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
S 0.00 earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
T 0.00 earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
U 0.00 earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
V 0.00 earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
W 0.00 earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
X 0.00 elemental_blast
Y 0.60 flame_shock,if=time>60&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<duration
After the initial Ascendance, use Flame Shock pre-emptively just before Ascendance to guarantee Flame Shock staying up for the full duration of the Ascendance buff
Z 3.87 searing_totem,if=(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
Keep Searing Totem up, unless Fire Elemental Totem is coming off cooldown in the next 20 seconds
a 0.00 spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))
b 96.50 lightning_bolt

Sample Sequence

01247CFOPNGNNNNNNNNNNMNNNNObbPbbbMNbbNbNONbQbbbNbbbOPbNNMZbbbNObbbQbNbNPObbbNNQNbbNObbNbbPbNbM7CObNZNbbbbbQNbONbbbNPNbbbNOQbbNbbNbbOQbNNPbbbbNG8NNNNMNNNNOPZbbbNbQbObbNbbbbNQObbPb7CNbbbbbObNQbbbbNbbPOZbNQbbbbNObbbbNbPbb

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana
Pre food Fluffy_Pillow 160000.0/160000: 100% mana
Pre lightning_shield Fluffy_Pillow 160000.0/160000: 100% mana
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 use_item_copelands_clarity Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 elemental_mastery Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion, sudden_clarity
0:00.000 fire_elemental_totem Fluffy_Pillow 160000.0/160000: 100% mana elemental_mastery, draenic_intellect_potion, sudden_clarity
0:01.004 unleash_flame Fluffy_Pillow 152613.9/160000: 95% mana bloodlust, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:02.009 flame_shock Fluffy_Pillow 152715.9/160000: 95% mana bloodlust, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, draenic_intellect_potion, sudden_clarity
0:03.013 lava_burst Fluffy_Pillow 153536.8/160000: 96% mana bloodlust, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:04.055 ascendance Fluffy_Pillow 154643.9/160000: 97% mana bloodlust, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:04.055 lava_burst Fluffy_Pillow 152979.9/160000: 96% mana bloodlust, ascendance, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:05.097 lava_burst Fluffy_Pillow 154087.0/160000: 96% mana bloodlust, ascendance, elemental_fusion, unleashed_fury, elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:06.140 lava_burst Fluffy_Pillow 155195.2/160000: 97% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:07.184 lava_burst Fluffy_Pillow 156304.7/160000: 98% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:08.225 lava_burst Fluffy_Pillow 157410.6/160000: 98% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:09.268 lava_burst Fluffy_Pillow 158518.9/160000: 99% mana bloodlust, ascendance, lava_surge, elemental_fusion(2), unleashed_fury, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:10.272 lava_burst Fluffy_Pillow 159579.8/160000: 100% mana bloodlust, ascendance, lava_surge, elemental_fusion(2), unleashed_fury, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:11.280 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:12.322 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:13.365 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:14.408 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:15.414 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion, elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:16.456 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion, elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:17.498 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:18.541 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:19.585 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:20.589 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:21.942 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:23.296 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:24.312 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury
0:25.664 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury
0:27.017 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury
0:28.370 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury
0:29.386 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury
0:30.740 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:32.092 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion
0:33.446 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion
0:34.462 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2)
0:35.815 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion(2)
0:36.833 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2)
0:37.849 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:38.865 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
0:40.218 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleashed_fury, enhanced_unleash, mark_of_the_frostwolf(2)
0:41.234 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf(2)
0:42.994 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf(2)
0:44.752 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf(2)
0:46.511 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
0:48.269 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
0:50.027 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
0:51.785 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
0:53.545 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
0:54.866 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
0:56.185 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
0:57.942 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
0:59.700 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury, mark_of_the_frostwolf
1:01.019 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
1:02.339 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
1:03.343 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
1:05.101 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
1:06.859 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
1:08.618 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
1:10.377 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
1:11.698 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
1:13.457 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
1:15.216 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, mark_of_the_frostwolf
1:16.974 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, mark_of_the_frostwolf
1:18.294 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, mark_of_the_frostwolf
1:20.053 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, mark_of_the_frostwolf
1:21.813 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
1:23.571 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, mark_of_the_frostwolf
1:24.890 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), mark_of_the_frostwolf
1:26.210 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana
1:27.531 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
1:29.287 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
1:31.046 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
1:32.803 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
1:34.562 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury
1:35.884 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), unleashed_fury
1:37.204 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge
1:38.525 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
1:40.283 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
1:42.041 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
1:43.363 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
1:44.681 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
1:46.440 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
1:48.198 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), unleash_flame, unleashed_fury
1:49.517 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
1:51.277 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
1:53.035 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
1:54.355 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, mark_of_the_frostwolf
1:56.115 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, mark_of_the_frostwolf
1:57.434 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
1:59.194 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
2:00.515 use_item_copelands_clarity Fluffy_Pillow 160000.0/160000: 100% mana
2:00.515 elemental_mastery Fluffy_Pillow 160000.0/160000: 100% mana sudden_clarity
2:00.515 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_mastery, sudden_clarity
2:01.529 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
2:02.882 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
2:03.898 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
2:04.902 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
2:05.919 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, sudden_clarity
2:07.272 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, sudden_clarity
2:08.626 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, sudden_clarity
2:09.978 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, sudden_clarity
2:11.330 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
2:12.682 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
2:13.696 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_mastery, sudden_clarity
2:15.050 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_mastery, mark_of_the_frostwolf, sudden_clarity
2:16.404 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, elemental_mastery, mark_of_the_frostwolf, sudden_clarity
2:17.423 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, sudden_clarity
2:18.440 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, sudden_clarity
2:19.793 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, sudden_clarity
2:21.148 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
2:22.905 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
2:24.225 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
2:25.544 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury, mark_of_the_frostwolf
2:26.863 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
2:28.622 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
2:30.381 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
2:32.140 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
2:33.459 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
2:34.780 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
2:36.102 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
2:37.861 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, mark_of_the_frostwolf
2:39.618 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleash_flame, unleashed_fury, mark_of_the_frostwolf
2:40.939 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:42.697 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:44.455 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
2:45.775 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
2:47.532 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
2:49.292 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
2:50.613 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
2:51.934 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
2:53.692 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
2:55.451 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury
2:56.771 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
2:58.091 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
2:59.849 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
3:01.608 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
3:03.366 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
3:05.125 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana
3:06.885 ascendance Fluffy_Pillow 160000.0/160000: 100% mana
3:06.885 potion Fluffy_Pillow 158336.0/160000: 99% mana ascendance
3:06.885 lava_burst Fluffy_Pillow 158336.0/160000: 99% mana ascendance, draenic_intellect_potion
3:08.644 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion, mark_of_the_frostwolf, draenic_intellect_potion
3:10.403 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), mark_of_the_frostwolf, draenic_intellect_potion
3:12.161 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), mark_of_the_frostwolf, draenic_intellect_potion
3:13.920 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), mark_of_the_frostwolf, draenic_intellect_potion
3:15.239 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion, draenic_intellect_potion
3:16.996 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion, draenic_intellect_potion
3:18.756 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:20.515 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:22.273 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), draenic_intellect_potion
3:23.595 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash, draenic_intellect_potion
3:24.916 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash, draenic_intellect_potion
3:25.919 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion
3:27.679 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf, draenic_intellect_potion
3:29.438 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf, draenic_intellect_potion
3:31.196 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf, draenic_intellect_potion
3:32.955 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana
3:34.714 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:36.036 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana
3:37.795 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana
3:39.113 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
3:40.871 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
3:42.630 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleash_flame, unleashed_fury
3:43.951 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
3:45.710 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf
3:47.467 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf
3:49.226 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
3:50.985 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
3:52.743 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:54.064 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:55.385 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
3:57.144 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
3:58.903 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury
4:00.224 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
4:01.983 use_item_copelands_clarity Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
4:01.983 elemental_mastery Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, sudden_clarity
4:01.983 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
4:03.337 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
4:04.691 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
4:06.044 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
4:07.399 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
4:08.753 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
4:10.108 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
4:11.125 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
4:12.479 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
4:13.833 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
4:14.848 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
4:16.201 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
4:17.554 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
4:18.907 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
4:20.261 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, elemental_mastery, sudden_clarity
4:21.277 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
4:22.631 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:24.389 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:25.710 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana
4:27.032 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
4:28.036 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
4:29.794 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, mark_of_the_frostwolf
4:31.553 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
4:32.873 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf
4:34.632 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf
4:36.391 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
4:38.151 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
4:39.910 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
4:41.669 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
4:42.989 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
4:44.747 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
4:46.506 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury
4:48.264 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, mark_of_the_frostwolf
4:50.019 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, mark_of_the_frostwolf
4:51.776 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), mark_of_the_frostwolf
4:53.535 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), mark_of_the_frostwolf
4:54.855 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana
4:56.613 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 692 692
Agility 1483 1413 1413
Stamina 4382 3984 3984
Intellect 4021 3567 3453 (2291)
Spirit 784 784 784
Health 262920 239040 0
Mana 160000 160000 0
Spell Power 5753 4776 1209
Crit 18.13% 13.13% 894
Haste 13.97% 8.54% 854
Multistrike 40.20% 33.61% 898
Damage / Heal Versatility 5.08% 2.08% 270
ManaReg per Second 1216 1216 0
Attack Power 1631 1413 0
Mastery 88.96% 66.46% 745
Armor 1979 1979 1979

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Persistence Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Rushing Streams Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast
100 Elemental Fusion Storm Elemental Totem Liquid Magma

Profile

shaman="Shaerlyn"
origin="http://eu.battle.net/wow/en/character/forscherliga/Shaerlyn/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/96/5141344-avatar.jpg"
level=100
race=draenei
role=spell
position=back
professions=jewelcrafting=710/enchanting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Wa!1220100
glyphs=chain_lightning/lightning_shield/spiritwalkers_focus/lakestrider/astral_recall/ghostly_speed
spec=elemental

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect

# Executed every time the actor is available.

actions=wind_shear
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions+=/bloodlust,if=target.health.pct<25|time>0.500
actions+=/use_item,name=copelands_clarity
# In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
actions+=/potion,name=draenic_intellect,if=buff.ascendance.up|target.time_to_die<=30
actions+=/berserking,if=!buff.bloodlust.up&!buff.elemental_mastery.up&(set_bonus.tier15_4pc_caster=1|(buff.ascendance.cooldown_remains=0&(dot.flame_shock.remains>buff.ascendance.duration|level<87)))
actions+=/blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
actions+=/arcane_torrent
actions+=/elemental_mastery,if=action.lava_burst.cast_time>=1.2
actions+=/ancestral_swiftness,if=!buff.ascendance.up
actions+=/storm_elemental_totem
actions+=/fire_elemental_totem,if=!active
actions+=/ascendance,if=active_enemies>1|(dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=60)&cooldown.lava_burst.remains>0)
actions+=/liquid_magma,if=pet.searing_totem.remains>=15|pet.fire_elemental_totem.remains>=15
# If only one enemy, priority follows the 'single' action list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On multiple enemies, the priority follows the 'aoe' action list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

# Single target action priority list

actions.single=unleash_flame,moving=1
actions.single+=/spiritwalkers_grace,moving=1,if=buff.ascendance.up
actions.single+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
actions.single+=/unleash_flame,if=talent.unleashed_fury.enabled&!buff.ascendance.up
actions.single+=/flame_shock,if=dot.flame_shock.remains<=9
actions.single+=/earth_shock,if=(set_bonus.tier17_4pc&buff.lightning_shield.react>=15&!buff.lava_surge.up)|(!set_bonus.tier17_4pc&buff.lightning_shield.react>15)
actions.single+=/earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
actions.single+=/earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
actions.single+=/earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
actions.single+=/earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
actions.single+=/earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
actions.single+=/earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
actions.single+=/elemental_blast
# After the initial Ascendance, use Flame Shock pre-emptively just before Ascendance to guarantee Flame Shock staying up for the full duration of the Ascendance buff
actions.single+=/flame_shock,if=time>60&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<duration
# Keep Searing Totem up, unless Fire Elemental Totem is coming off cooldown in the next 20 seconds
actions.single+=/searing_totem,if=(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
actions.single+=/spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))
actions.single+=/lightning_bolt

# Multi target action priority list

actions.aoe=earthquake,cycle_targets=1,if=!ticking&(buff.enhanced_chain_lightning.up|level<=90)&active_enemies>=2
actions.aoe+=/lava_beam
actions.aoe+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.aoe+=/thunderstorm,if=active_enemies>=10
actions.aoe+=/searing_totem,if=(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
actions.aoe+=/chain_lightning,if=active_enemies>=2
actions.aoe+=/lightning_bolt

head=hood_of_dispassionate_execution,id=113608
neck=primal_gladiators_pendant_of_cruelty,id=115655,enchant=75mult
shoulders=primal_gladiators_ringmail_spaulders,id=115724
back=primal_gladiators_drape_of_cruelty,id=115651,enchant=gift_of_multistrike
chest=undying_chestguard,id=114498,bonus_id=53
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=bracers_of_the_crying_chorus,id=113826,bonus_id=40/563,gems=35mult
hands=longshot_gauntlets,id=118973,bonus_id=123/563,gems=35mult
waist=belt_of_imminent_lies,id=113827
legs=exceptional_crystalleaf_legguards,id=116929
feet=undying_boots,id=114503,bonus_id=146
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=50mult
finger2=whispering_taladite_ring,id=115798,bonus_id=76/526/539,enchant=30mult
trinket1=quiescent_runestone,id=113859
trinket2=copelands_clarity,id=118878
main_hand=butchers_terrible_tenderizer,id=113607,enchant=mark_of_the_frostwolf
off_hand=maw_of_souls,id=113653,bonus_id=564/566,gems=50mult

# Gear Summary
# gear_stamina=3094
# gear_intellect=2291
# gear_spell_power=1209
# gear_crit_rating=894
# gear_haste_rating=854
# gear_mastery_rating=745
# gear_armor=1979
# gear_multistrike_rating=855
# gear_versatility_rating=270
# gear_avoidance_rating=68

Candylicious

Candylicious : 22055 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22054.9 22054.9 6.9 / 0.031% 2136.2 / 9.7% 1.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
13769.9 13769.9 Mana 2.54% 41.9 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Candylicious/advanced
Talents
  • 15: Soul Leech
  • 30: Mortal Coil
  • 45: Soul Link
  • 60: Blood Horror
  • 75: Grimoire of Supremacy
  • 90: Kil'jaeden's Cunning
  • 100: Demonic Servitude
  • Talent Calculator
Glyphs
  • Glyph of Siphon Life
  • Glyph of Havoc
  • Glyph of Demon Training
  • Glyph of Nightmares
  • Glyph of Verdant Spheres
Professions
  • inscription: 189
  • tailoring: 700

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Candylicious+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x150&chd=t:29752|29343|20628|10020&chds=0,59504&chco=9482C9,C41F3B,C41F3B,C41F3B&chm=t++29752++chaos_bolt,9482C9,0,0,15|t++29343++immolate,C41F3B,1,0,15|t++20628++conflagrate,C41F3B,2,0,15|t++10020++incinerate,C41F3B,3,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Candylicious+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:38,36,32,16,11,2&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,9482C9,C41F3B,C41F3B,C79C6E&chl=incinerate|terrorguard: doom_bolt|chaos_bolt|immolate|conflagrate|shattered_bleed&
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Candylicious+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Vcdorsuxz487656776544yxpnommmigffffebbababbZaZZaYZZYYZXYZZZYZYYaaabYZZYaaZZaaabbZabZaZYbaabaZabZaaYaaaZbZZbYaaZZZZYdcfihikllopnpooqrrssopmkljghgdcdccdbaaaZaXXXXYZYXYYXXXWXYXYXWYYXYXWYZYZZYYYYYZYYaZZbZZaZYZZZbcacbaccbccacdbddccdccdbcdbbcefkjjmlnqpqrpprtsuuutsopoklkhiigiiggfeeecccbceccdccdbbcbcccbcdbccacdcddbccbdcbcdccedcdccdbcedefddeedffdfgfggfghfggfggfffdefcdcbaZXVUSRQNML&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.52514,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=22055|max=41998&chxp=1,1,53,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Candylicious+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,3,3,7,12,19,43,64,96,173,228,301,414,510,627,799,821,998,1072,1139,1282,1324,1350,1456,1390,1264,1308,1191,1137,1085,960,851,689,531,449,375,307,199,155,110,81,69,47,18,14,13,2,3,6,3&chds=0,1456&chbh=5&chxt=x&chxl=0:|min=20129|avg=22055|max=24153&chxp=0,1,48,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Candylicious+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:62.1,17.5,8.8,8.8,2.5&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C41F3B,C41F3B,ffffff&chl=incinerate 186.8s|chaos_bolt 52.7s|immolate 26.6s|conflagrate 26.5s|waiting 7.6s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Candylicious 22055
chaos_bolt 5229 23.7% 24.8 12.00sec 63241 29752 Direct 24.6 0 59797 59797 100.0% 5.4 0 17926 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.82 24.62 0.00 0.00 2.1256 0.0000 1569389.97 1569389.97 0.00 29752.03 29752.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.42 100.00% 17925.65 15124 24821 17863.28 0 24821 97147 97147 0.00
crit 24.62 100.00% 59796.80 50414 82738 59876.51 56181 64722 1472242 1472242 0.00
 
DPS Timeline Chart
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.havoc.remains>cast_time&buff.havoc.stack>=3
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:shadow
  • tooltip:Deals Shadow damage every $t2 sec.
  • description:Unleashes a blast of chaos, causing ${$m1*(1+$77220m1/100*$<masteryMod>)} Shadow damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.{$?s116858=true}[][ Replaces Soul Fire.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.107500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
conflagrate 1819 8.2% 26.4 11.57sec 20721 20628 Direct 26.4 14658 30155 19440 30.9% 5.8 4398 9041 30.8%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.36 26.36 0.00 0.00 1.0045 0.0000 546263.27 546263.27 0.00 20628.50 20628.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.79 30.82% 9040.56 8515 10343 7550.81 0 10343 16141 16141 0.00
multistrike 4.01 69.18% 4397.71 4257 5171 4317.07 0 5171 17622 17622 0.00
hit 18.23 69.14% 14658.35 14191 17238 14662.67 14191 15597 267192 267192 0.00
crit 8.13 30.86% 30154.88 28382 34476 30200.34 28382 34476 245308 245308 0.00
 
DPS Timeline Chart
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Target enemy instantly explodes, dealing {$s1=2077} Fire damage{$?s56235=false}[, reducing movement speed by {$s2=50}% for {$d=5 seconds},][] and generating Burning Embers.{$?s56235=false}[][ Targets afflicted by Immolate will have {$s2=50}% reduced movement speed for {$d=5 seconds}.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.890000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
immolate 2595 11.8% 20.6 14.91sec 37879 29343 Direct 20.6 7089 14568 9211 28.4% 4.5 2126 4365 28.5%  
Periodic 118.1 3522 7219 4587 28.8% 25.9 1059 2171 28.9% 99.3%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.58 20.58 118.12 118.12 1.2910 2.5292 779697.52 779697.52 0.00 2396.58 29342.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.29 28.49% 4365.45 4130 5016 3184.03 0 5016 5642 5642 0.00
multistrike 3.24 71.51% 2126.27 2065 2508 2046.98 0 2508 6896 6896 0.00
hit 14.74 71.62% 7088.55 6883 8360 7091.13 6883 7516 104502 104502 0.00
crit 5.84 28.38% 14568.11 13766 16721 14585.34 0 16721 85099 85099 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.5 28.89% 2170.84 2064 2508 2170.59 0 2508 16229 16229 0.00
multistrike 18.4 71.11% 1059.37 1032 1254 1059.94 1032 1186 19490 19490 0.00
hit 84.1 71.18% 3521.59 5 4180 3523.24 3383 3625 296114 296114 0.00
crit 34.0 28.82% 7218.86 10 8359 7224.50 6666 7717 245726 245726 0.00
 
DPS Timeline Chart
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy for {$s1=505} Fire damage and an additional $157736o1 Fire damage over {$157736d=15 seconds}.{$?s108647=false}[ Immolate critical strikes generate Burning Embers.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.989820
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.494910
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
incinerate 6227 28.3% 134.5 2.23sec 13913 10020 Direct 133.6 10240 20946 13140 27.1% 29.3 3072 6283 27.1%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.51 133.63 0.00 0.00 1.3886 0.0000 1871463.05 1871463.05 0.00 10019.56 10019.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.95 27.10% 6282.66 5985 7270 6283.92 0 7270 49924 49924 0.00
multistrike 21.37 72.90% 3071.86 2992 3635 3072.98 2992 3359 65655 65655 0.00
hit 97.44 72.92% 10239.79 9975 12116 10243.07 9998 10510 997769 997769 0.00
crit 36.19 27.08% 20945.85 19949 24232 20959.09 19949 22370 758115 758115 0.00
 
DPS Timeline Chart
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:32000.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Deals {$s1=1461} Fire damage to an enemy{$?s108647=false}[ and generates Burning Embers][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.328250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shattered_bleed 386 1.8% 17.5 17.52sec 6632 0 Direct 17.5 1554 3108 1910 22.9% 3.8 466 932 22.9%  
Periodic 98.2 767 0 767 0.0% 21.5 233 0 0.0% 32.6%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.48 17.48 98.18 98.18 0.0000 1.0000 115944.67 115944.67 0.00 1180.96 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.88 22.90% 932.40 932 932 545.72 0 932 820 820 0.00
multistrike 2.96 77.10% 466.20 466 466 439.91 0 466 1381 1381 0.00
hit 13.47 77.07% 1554.00 1554 1554 1554.00 1554 1554 20939 20939 0.00
crit 4.01 22.93% 3108.00 3108 3108 3057.40 0 3108 12457 12457 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 21.5 100.00% 233.10 233 233 233.10 233 233 5023 5023 0.00
hit 98.2 100.00% 767.23 1 777 767.49 738 777 75325 75325 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - terrorguard 5799 / 5799
doom_bolt 5799 26.3% 103.3 2.90sec 16859 6689 Direct 102.7 12187 24938 15917 29.3% 22.5 3656 7486 29.2%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.32 102.68 0.00 0.00 2.5204 0.0000 1741810.37 1741810.37 0.00 6689.03 6689.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.57 29.17% 7485.68 6829 9954 7477.28 0 9954 49181 49181 0.00
multistrike 15.95 70.83% 3656.06 3414 4977 3656.84 3414 4352 58318 58318 0.00
hit 72.64 70.75% 12186.78 11382 16590 12189.76 11712 12699 885257 885257 0.00
crit 30.04 29.25% 24937.62 22763 33181 24959.36 23188 27842 749054 749054 0.00
 
DPS Timeline Chart
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1781} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.{$?s152107=false}[ Master gains {$s3=6} Demonic Fury. |cFF777777(Right-Click to toggle)|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.620000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Candylicious
dark_soul 3.0 120.97sec

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.32 77.27% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.68 22.73% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: dark_soul

Static Values
  • id:113858
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:8000.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
Spelldata
  • id:113858
  • name:Dark Soul: Instability
  • school:fire
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by {$113858s1=30}% for {$113858d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
summon_terrorguard 1.0 0.00sec

Stats details: summon_terrorguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.59 79.37% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.41 20.63% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_terrorguard

Static Values
  • id:112927
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:20000.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic_servitude.enabled&active_enemies<5
Spelldata
  • id:112927
  • name:Summon Terrorguard
  • school:shadow
  • tooltip:
  • description:Summons a Terrorguard for {$112926d=60 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
backdraft 24.4 1.9 12.5sec 11.6sec 50.72% 50.72% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_backdraft
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • backdraft_1:13.15%
  • backdraft_2:16.28%
  • backdraft_3:19.22%
  • backdraft_4:0.98%
  • backdraft_5:0.43%
  • backdraft_6:0.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate's cast time and mana cost reduced by {$s1=30}%.$?$W3<>0[ Chaos Bolt's cast time reduced by {$s3=30}%][]
  • description:{$@spelldesc117896=When you cast Conflagrate, the cast time and mana cost of your next Chaos Bolt or next three Incinerates is reduced by {$117828s1=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 24.32% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul (dark_soul) 3.0 0.0 121.0sec 121.0sec 19.26% 42.76% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • dark_soul_1:19.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113858
  • name:Dark Soul: Instability
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by {$113858s1=30}% for {$113858d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 238.5sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
nightmare_fire 2.9 0.0 124.2sec 124.1sec 18.40% 18.41% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Candylicious
chaos_bolt Burning Ember 24.8 24.8 1.0 1.0 63240.9
conflagrate Mana 26.4 168722.3 6400.0 6400.0 3.2
dark_soul Mana 3.0 24016.0 8000.0 8000.0 0.0
immolate Mana 20.6 395211.0 19200.0 19200.1 2.0
incinerate Mana 134.5 3555447.4 26432.0 26432.1 0.5
pet - terrorguard
doom_bolt Energy 103.3 3616.1 35.0 35.0 481.7
Resource Gains Type Count Total Average Overflow
incinerate Burning Ember 134.51 17.10 (69.68%) 0.13 0.00 0.00%
immolate Burning Ember 39.88 3.99 (16.26%) 0.10 0.00 0.00%
conflagrate Burning Ember 26.36 3.45 (14.06%) 0.13 0.00 0.00%
external_healing Health 8.47 0.00 (0.00%) 0.00 78276.35 100.00%
mp5_regen Mana 284.39 4079607.93 (100.00%) 14345.23 47046.75 1.14%
soul_leech Health 133.63 0.00 (0.00%) 0.00 263385.09 100.00%
siphon_life Health 118.12 0.00 (0.00%) 0.00 1171349.74 100.00%
pet - terrorguard
energy_regen Energy 496.96 3551.23 (100.00%) 7.15 3.99 0.11%
Resource RPS-Gain RPS-Loss
Mana 13557.89 13769.85
Burning Ember 0.08 0.08
Combat End Resource Mean Min Max
Mana 104340.44 22075.35 159161.82
Burning Ember 0.59 0.00 1.50
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.8%
felhunter-Mana Cap 0.8%
imp-Mana Cap 0.8%
succubus-Mana Cap 0.8%
voidwalker-Mana Cap 0.8%
infernal-Mana Cap 0.8%
doomguard-Mana Cap 0.8%
observer-Mana Cap 0.8%
fel_imp-Mana Cap 0.8%
shivarra-Mana Cap 0.8%
voidlord-Mana Cap 0.8%
abyssal-Mana Cap 0.8%
terrorguard-Mana Cap 0.8%
service_felhunter-Mana Cap 0.8%
service_imp-Mana Cap 0.8%
service_succubus-Mana Cap 0.8%
service_voidwalker-Mana Cap 0.8%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Candylicious Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Candylicious Damage Per Second
Count 25000
Mean 22054.86
Minimum 20129.37
Maximum 24152.93
Spread ( max - min ) 4023.55
Range [ ( max - min ) / 2 * 100% ] 9.12%
Standard Deviation 554.6091
5th Percentile 21157.77
95th Percentile 22972.99
( 95th Percentile - 5th Percentile ) 1815.22
Mean Distribution
Standard Deviation 3.5077
95.00% Confidence Intervall ( 22047.99 - 22061.74 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2429
0.1 Scale Factor Error with Delta=300 2625
0.05 Scale Factor Error with Delta=300 10503
0.01 Scale Factor Error with Delta=300 262577
Distribution Chart
DPS(e)
Sample Data Candylicious Damage Per Second (Effective)
Count 25000
Mean 22054.86
Minimum 20129.37
Maximum 24152.93
Spread ( max - min ) 4023.55
Range [ ( max - min ) / 2 * 100% ] 9.12%
Damage
Sample Data Candylicious Damage
Count 25000
Mean 4882758.48
Minimum 3587220.67
Maximum 6213739.05
Spread ( max - min ) 2626518.38
Range [ ( max - min ) / 2 * 100% ] 26.90%
DTPS
Sample Data Candylicious Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Candylicious Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Candylicious Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Candylicious Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Candylicious Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Candylicious Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data CandyliciousTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Candylicious Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet,if=!talent.demonic_servitude.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down)
4 0.00 summon_doomguard,if=talent.demonic_servitude.enabled&active_enemies<5
5 0.00 summon_infernal,if=talent.demonic_servitude.enabled&active_enemies>=5
6 0.00 snapshot_stats
7 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled&!talent.demonic_servitude.enabled
8 0.00 service_pet,if=talent.grimoire_of_service.enabled
9 0.00 potion,name=draenic_intellect
A 0.00 incinerate
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 potion,name=draenic_intellect,if=buff.bloodlust.react|target.health.pct<=20
C 0.00 berserking
D 0.00 blood_fury
E 0.00 arcane_torrent
F 0.00 mannoroths_fury
G 3.00 dark_soul,if=!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
H 0.00 service_pet,if=talent.grimoire_of_service.enabled
I 0.00 summon_doomguard,if=!talent.demonic_servitude.enabled&active_enemies<5
J 0.00 summon_infernal,if=!talent.demonic_servitude.enabled&active_enemies>=5
K 0.00 run_action_list,name=single_target,if=active_enemies<6
L 0.00 run_action_list,name=aoe,if=active_enemies>=6
actions.single_target
# count action,conditions
M 0.00 havoc,target=2
N 0.00 shadowburn,if=talent.charred_remains.enabled&(burning_ember>=2.5|buff.dark_soul.up|target.time_to_die<10)
O 0.00 cataclysm,if=active_enemies>1
P 0.00 fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=action.immolate.cast_time&(cooldown.cataclysm.remains>action.immolate.cast_time|!talent.cataclysm.enabled)&active_enemies>4
Q 1.65 immolate,cycle_targets=1,if=remains<=cast_time&(cooldown.cataclysm.remains>cast_time|!talent.cataclysm.enabled)
R 0.00 cancel_buff,name=fire_and_brimstone,if=buff.fire_and_brimstone.up&dot.immolate.remains>(dot.immolate.duration*0.3)
S 0.00 shadowburn,if=buff.havoc.remains
T 0.00 chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
U 1.00 conflagrate,if=charges=2
V 0.00 cataclysm
W 0.00 rain_of_fire,if=remains<=tick_time&(active_enemies>4|(buff.mannoroths_fury.up&active_enemies>2))
X 0.00 chaos_bolt,if=talent.charred_remains.enabled&active_enemies>1&target.health.pct>20
Y 0.00 chaos_bolt,if=talent.charred_remains.enabled&buff.backdraft.stack<3&burning_ember>=2.5
Z 23.10 chaos_bolt,if=buff.backdraft.stack<3&(burning_ember>=3.5|buff.dark_soul.up|(burning_ember>=3&buff.ember_master.react)|target.time_to_die<20)
a 0.00 chaos_bolt,if=buff.backdraft.stack<3&set_bonus.tier17_2pc=1&burning_ember>=2.5
b 0.00 chaos_bolt,if=buff.backdraft.stack<3&buff.archmages_greater_incandescence_int.react&buff.archmages_greater_incandescence_int.remains>cast_time
c 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time
d 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.intellect.react>7&trinket.stacking_proc.intellect.remains>=cast_time
e 1.89 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.crit.react&trinket.proc.crit.remains>cast_time
f 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.multistrike.react>=8&trinket.stacking_proc.multistrike.remains>=cast_time
g 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.multistrike.react&trinket.proc.multistrike.remains>cast_time
h 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time
i 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time
j 0.00 fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=(dot.immolate.duration*0.3)&active_enemies>4
k 19.03 immolate,cycle_targets=1,if=remains<=(duration*0.3)
l 25.36 conflagrate
m 134.15 incinerate

Sample Sequence

0149AGQUlmmmmZZmmklmZmmmmmmmlkmmmmmmmmlmmmkmZmlmmmmZkmmlmmmmZmklmmmmmmZklmmmmmZlmmkmmmlmZmmmkeGZZlmmmZklmmmZmmmlkmmmmmmlmmmkmmmmlmmmmkmlmmmZmmklmmmmZmlmkmmmmZlmmmkmmmZlmmmBkmmGZZZlmZklmmmmZmmlmkmmemmmlmmkmZmmlmmmZk

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre food Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre summon_terrorguard Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre potion Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember draenic_intellect_potion
0:00.000 incinerate Fluffy_Pillow 136000.0/168000: 81% mana | 1.1/4: 28% burning_ember draenic_intellect_potion
0:00.000 dark_soul Fluffy_Pillow 136000.0/168000: 81% mana | 1.0/4: 25% burning_ember draenic_intellect_potion
0:00.000 immolate Fluffy_Pillow 128000.0/168000: 76% mana | 1.0/4: 25% burning_ember dark_soul, draenic_intellect_potion
0:01.321 conflagrate Fluffy_Pillow 131499.8/168000: 78% mana | 1.0/4: 25% burning_ember bloodlust, dark_soul, nightmare_fire, draenic_intellect_potion
0:02.325 conflagrate Fluffy_Pillow 142352.3/168000: 85% mana | 1.2/4: 30% burning_ember bloodlust, backdraft(3), dark_soul, nightmare_fire, draenic_intellect_potion
0:03.331 incinerate Fluffy_Pillow 153239.1/168000: 91% mana | 1.4/4: 35% burning_ember bloodlust, backdraft(6), dark_soul, nightmare_fire, draenic_intellect_potion
0:04.333 incinerate Fluffy_Pillow 148057.3/168000: 88% mana | 1.7/4: 43% burning_ember bloodlust, backdraft(5), dark_soul, nightmare_fire, draenic_intellect_potion
0:05.336 incinerate Fluffy_Pillow 142892.6/168000: 85% mana | 1.8/4: 45% burning_ember bloodlust, backdraft(4), dark_soul, nightmare_fire, draenic_intellect_potion
0:06.339 incinerate Fluffy_Pillow 137727.9/168000: 82% mana | 2.0/4: 50% burning_ember bloodlust, backdraft(3), dark_soul, nightmare_fire, draenic_intellect_potion
0:07.344 chaos_bolt Fluffy_Pillow 132597.6/168000: 79% mana | 2.2/4: 55% burning_ember bloodlust, backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
0:09.036 chaos_bolt Fluffy_Pillow 161672.5/168000: 96% mana | 1.3/4: 33% burning_ember bloodlust, backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
0:10.728 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.4/4: 10% burning_ember bloodlust, backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
0:11.733 incinerate Fluffy_Pillow 162869.7/168000: 97% mana | 0.7/4: 18% burning_ember bloodlust, backdraft, dark_soul, nightmare_fire, draenic_intellect_potion
0:12.739 immolate Fluffy_Pillow 157756.6/168000: 94% mana | 0.9/4: 23% burning_ember bloodlust, dark_soul, nightmare_fire, draenic_intellect_potion
0:13.755 conflagrate Fluffy_Pillow 156015.3/168000: 93% mana | 0.9/4: 23% burning_ember bloodlust, dark_soul, nightmare_fire, draenic_intellect_potion
0:14.759 incinerate Fluffy_Pillow 166867.8/168000: 99% mana | 1.1/4: 28% burning_ember bloodlust, backdraft(3), dark_soul, nightmare_fire, draenic_intellect_potion
0:15.761 chaos_bolt Fluffy_Pillow 161685.9/168000: 96% mana | 1.4/4: 35% burning_ember bloodlust, backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
0:17.455 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.4/4: 10% burning_ember bloodlust, backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
0:18.461 incinerate Fluffy_Pillow 162886.9/168000: 97% mana | 0.7/4: 18% burning_ember bloodlust, backdraft, dark_soul, nightmare_fire, draenic_intellect_potion
0:19.465 incinerate Fluffy_Pillow 157739.4/168000: 94% mana | 0.9/4: 23% burning_ember bloodlust, dark_soul, nightmare_fire, draenic_intellect_potion
0:20.820 incinerate Fluffy_Pillow 149023.4/168000: 89% mana | 1.1/4: 28% burning_ember bloodlust, nightmare_fire
0:22.173 incinerate Fluffy_Pillow 140273.0/168000: 83% mana | 1.2/4: 30% burning_ember bloodlust
0:23.528 incinerate Fluffy_Pillow 131557.0/168000: 78% mana | 1.4/4: 35% burning_ember bloodlust
0:24.883 incinerate Fluffy_Pillow 122841.0/168000: 73% mana | 1.6/4: 40% burning_ember bloodlust
0:26.237 conflagrate Fluffy_Pillow 114107.9/168000: 68% mana | 1.8/4: 45% burning_ember bloodlust
0:27.244 immolate Fluffy_Pillow 125011.9/168000: 74% mana | 1.9/4: 48% burning_ember bloodlust, backdraft(3)
0:28.259 incinerate Fluffy_Pillow 123253.4/168000: 73% mana | 1.9/4: 48% burning_ember bloodlust, backdraft(3)
0:29.264 incinerate Fluffy_Pillow 118123.1/168000: 70% mana | 2.0/4: 50% burning_ember bloodlust, backdraft(2)
0:30.268 incinerate Fluffy_Pillow 112975.6/168000: 67% mana | 2.1/4: 53% burning_ember bloodlust, backdraft
0:31.272 incinerate Fluffy_Pillow 107828.1/168000: 64% mana | 2.2/4: 55% burning_ember bloodlust
0:32.627 incinerate Fluffy_Pillow 99112.1/168000: 59% mana | 2.4/4: 60% burning_ember bloodlust
0:33.982 incinerate Fluffy_Pillow 90396.2/168000: 54% mana | 2.5/4: 63% burning_ember bloodlust
0:35.336 incinerate Fluffy_Pillow 81663.0/168000: 49% mana | 2.7/4: 68% burning_ember bloodlust
0:36.689 incinerate Fluffy_Pillow 72912.6/168000: 43% mana | 2.9/4: 73% burning_ember bloodlust
0:38.045 conflagrate Fluffy_Pillow 64213.8/168000: 38% mana | 3.0/4: 75% burning_ember bloodlust
0:39.049 incinerate Fluffy_Pillow 75066.3/168000: 45% mana | 3.1/4: 78% burning_ember bloodlust, backdraft(3)
0:40.054 incinerate Fluffy_Pillow 69936.0/168000: 42% mana | 3.2/4: 80% burning_ember bloodlust, backdraft(2)
0:41.059 incinerate Fluffy_Pillow 60820.4/168000: 36% mana | 3.3/4: 83% burning_ember backdraft
0:42.293 immolate Fluffy_Pillow 54731.7/168000: 33% mana | 3.4/4: 85% burning_ember
0:43.612 incinerate Fluffy_Pillow 52966.7/168000: 32% mana | 3.4/4: 85% burning_ember
0:45.370 chaos_bolt Fluffy_Pillow 44204.4/168000: 26% mana | 3.6/4: 90% burning_ember
0:47.566 incinerate Fluffy_Pillow 73231.8/168000: 44% mana | 2.6/4: 65% burning_ember
0:49.326 conflagrate Fluffy_Pillow 64495.9/168000: 38% mana | 2.8/4: 70% burning_ember
0:50.331 incinerate Fluffy_Pillow 71380.3/168000: 42% mana | 3.0/4: 75% burning_ember backdraft(3)
0:51.564 incinerate Fluffy_Pillow 65278.5/168000: 39% mana | 3.1/4: 78% burning_ember backdraft(2)
0:52.795 incinerate Fluffy_Pillow 59150.2/168000: 35% mana | 3.3/4: 83% burning_ember backdraft
0:54.029 incinerate Fluffy_Pillow 53061.5/168000: 32% mana | 3.4/4: 85% burning_ember
0:55.789 chaos_bolt Fluffy_Pillow 44325.7/168000: 26% mana | 3.6/4: 90% burning_ember
0:57.988 immolate Fluffy_Pillow 73392.7/168000: 44% mana | 2.6/4: 65% burning_ember
0:59.307 incinerate Fluffy_Pillow 71627.6/168000: 43% mana | 2.6/4: 65% burning_ember
1:01.065 incinerate Fluffy_Pillow 62865.4/168000: 37% mana | 2.7/4: 68% burning_ember
1:02.825 conflagrate Fluffy_Pillow 54129.6/168000: 32% mana | 2.8/4: 70% burning_ember
1:03.830 incinerate Fluffy_Pillow 61013.9/168000: 36% mana | 2.9/4: 73% burning_ember backdraft(3)
1:05.061 incinerate Fluffy_Pillow 54885.6/168000: 33% mana | 3.0/4: 75% burning_ember backdraft(2)
1:06.293 incinerate Fluffy_Pillow 48770.6/168000: 29% mana | 3.2/4: 80% burning_ember backdraft
1:07.527 incinerate Fluffy_Pillow 42681.9/168000: 25% mana | 3.4/4: 85% burning_ember
1:09.288 chaos_bolt Fluffy_Pillow 33959.3/168000: 20% mana | 3.5/4: 88% burning_ember
1:11.484 incinerate Fluffy_Pillow 62986.7/168000: 37% mana | 2.5/4: 63% burning_ember
1:13.244 immolate Fluffy_Pillow 54250.9/168000: 32% mana | 2.6/4: 65% burning_ember
1:14.564 conflagrate Fluffy_Pillow 52499.0/168000: 31% mana | 2.6/4: 65% burning_ember
1:15.568 incinerate Fluffy_Pillow 59370.1/168000: 35% mana | 2.7/4: 68% burning_ember backdraft(3)
1:16.801 incinerate Fluffy_Pillow 53268.3/168000: 32% mana | 2.9/4: 73% burning_ember backdraft(2)
1:18.033 incinerate Fluffy_Pillow 47153.2/168000: 28% mana | 3.0/4: 75% burning_ember backdraft
1:19.266 incinerate Fluffy_Pillow 41051.4/168000: 24% mana | 3.1/4: 78% burning_ember
1:21.026 incinerate Fluffy_Pillow 32315.5/168000: 19% mana | 3.2/4: 80% burning_ember
1:22.787 Waiting 0.700 sec 23592.9/168000: 14% mana | 3.4/4: 85% burning_ember
1:23.487 incinerate Fluffy_Pillow 32845.7/168000: 20% mana | 3.4/4: 85% burning_ember
1:25.246 chaos_bolt Fluffy_Pillow 24096.7/168000: 14% mana | 3.6/4: 90% burning_ember
1:27.443 immolate Fluffy_Pillow 53137.3/168000: 32% mana | 2.6/4: 65% burning_ember
1:28.763 conflagrate Fluffy_Pillow 51385.4/168000: 31% mana | 2.7/4: 68% burning_ember
1:29.768 incinerate Fluffy_Pillow 58269.8/168000: 35% mana | 2.8/4: 70% burning_ember backdraft(3)
1:31.001 incinerate Fluffy_Pillow 52167.9/168000: 31% mana | 3.0/4: 75% burning_ember backdraft(2)
1:32.232 incinerate Fluffy_Pillow 46039.6/168000: 27% mana | 3.1/4: 78% burning_ember backdraft
1:33.464 incinerate Fluffy_Pillow 39924.6/168000: 24% mana | 3.3/4: 83% burning_ember
1:35.223 Waiting 0.100 sec 31175.5/168000: 19% mana | 3.4/4: 85% burning_ember
1:35.323 incinerate Fluffy_Pillow 32497.3/168000: 19% mana | 3.4/4: 85% burning_ember
1:37.081 chaos_bolt Fluffy_Pillow 23735.1/168000: 14% mana | 3.5/4: 88% burning_ember
1:39.279 conflagrate Fluffy_Pillow 52788.9/168000: 31% mana | 2.5/4: 63% burning_ember
1:40.283 incinerate Fluffy_Pillow 59660.0/168000: 36% mana | 2.7/4: 68% burning_ember backdraft(3)
1:41.517 incinerate Fluffy_Pillow 53571.4/168000: 32% mana | 2.8/4: 70% burning_ember backdraft(2)
1:42.750 immolate Fluffy_Pillow 47469.5/168000: 28% mana | 2.9/4: 73% burning_ember backdraft
1:44.071 incinerate Fluffy_Pillow 45730.9/168000: 27% mana | 2.9/4: 73% burning_ember backdraft
1:45.302 incinerate Fluffy_Pillow 39602.6/168000: 24% mana | 3.1/4: 78% burning_ember
1:47.063 Waiting 0.100 sec 30880.0/168000: 18% mana | 3.2/4: 80% burning_ember
1:47.163 incinerate Fluffy_Pillow 32201.8/168000: 19% mana | 3.2/4: 80% burning_ember
1:48.922 Waiting 0.400 sec 23452.8/168000: 14% mana | 3.3/4: 83% burning_ember
1:49.322 conflagrate Fluffy_Pillow 28740.1/168000: 17% mana | 3.3/4: 83% burning_ember
1:50.329 incinerate Fluffy_Pillow 35650.9/168000: 21% mana | 3.4/4: 85% burning_ember backdraft(3)
1:51.562 chaos_bolt Fluffy_Pillow 29549.1/168000: 18% mana | 3.6/4: 90% burning_ember backdraft(2)
1:53.758 incinerate Fluffy_Pillow 58576.4/168000: 35% mana | 2.7/4: 68% burning_ember backdraft(2)
1:54.991 incinerate Fluffy_Pillow 52474.6/168000: 31% mana | 2.8/4: 70% burning_ember backdraft
1:56.223 incinerate Fluffy_Pillow 46359.5/168000: 28% mana | 2.9/4: 73% burning_ember
1:57.983 immolate Fluffy_Pillow 37623.7/168000: 22% mana | 3.0/4: 75% burning_ember nightmare_fire
1:59.304 chaos_bolt Fluffy_Pillow 35885.0/168000: 21% mana | 3.2/4: 80% burning_ember nightmare_fire
2:01.501 dark_soul Fluffy_Pillow 64925.6/168000: 39% mana | 2.2/4: 55% burning_ember nightmare_fire
2:01.501 chaos_bolt Fluffy_Pillow 56925.6/168000: 34% mana | 2.2/4: 55% burning_ember dark_soul, nightmare_fire
2:03.698 chaos_bolt Fluffy_Pillow 85966.2/168000: 51% mana | 1.3/4: 33% burning_ember dark_soul, nightmare_fire
2:05.896 conflagrate Fluffy_Pillow 115019.9/168000: 68% mana | 0.3/4: 8% burning_ember dark_soul, nightmare_fire
2:06.900 incinerate Fluffy_Pillow 121891.1/168000: 73% mana | 0.4/4: 10% burning_ember backdraft(3), dark_soul, nightmare_fire
2:08.132 incinerate Fluffy_Pillow 115776.0/168000: 69% mana | 0.5/4: 13% burning_ember backdraft(2), dark_soul, nightmare_fire
2:09.364 incinerate Fluffy_Pillow 109661.0/168000: 65% mana | 0.8/4: 20% burning_ember backdraft, dark_soul, nightmare_fire
2:10.597 chaos_bolt Fluffy_Pillow 103559.1/168000: 62% mana | 1.0/4: 25% burning_ember dark_soul, nightmare_fire
2:12.794 immolate Fluffy_Pillow 132599.7/168000: 79% mana | 0.0/4: 0% burning_ember dark_soul, nightmare_fire
2:14.116 conflagrate Fluffy_Pillow 130874.2/168000: 78% mana | 0.2/4: 5% burning_ember dark_soul, nightmare_fire
2:15.121 incinerate Fluffy_Pillow 137758.6/168000: 82% mana | 0.3/4: 8% burning_ember backdraft(3), dark_soul, nightmare_fire
2:16.353 incinerate Fluffy_Pillow 131643.5/168000: 78% mana | 0.5/4: 13% burning_ember backdraft(2), dark_soul, nightmare_fire
2:17.586 incinerate Fluffy_Pillow 125541.7/168000: 75% mana | 0.8/4: 20% burning_ember backdraft, dark_soul, nightmare_fire
2:18.819 chaos_bolt Fluffy_Pillow 119439.8/168000: 71% mana | 1.0/4: 25% burning_ember dark_soul
2:21.016 incinerate Fluffy_Pillow 148480.4/168000: 88% mana | 0.0/4: 0% burning_ember dark_soul
2:22.776 incinerate Fluffy_Pillow 139744.6/168000: 83% mana | 0.1/4: 3% burning_ember
2:24.537 incinerate Fluffy_Pillow 131022.0/168000: 78% mana | 0.2/4: 5% burning_ember
2:26.297 conflagrate Fluffy_Pillow 122286.2/168000: 73% mana | 0.3/4: 8% burning_ember
2:27.301 immolate Fluffy_Pillow 129157.3/168000: 77% mana | 0.5/4: 13% burning_ember backdraft(3)
2:28.623 incinerate Fluffy_Pillow 127431.9/168000: 76% mana | 0.5/4: 13% burning_ember backdraft(3)
2:29.855 incinerate Fluffy_Pillow 121316.8/168000: 72% mana | 0.6/4: 15% burning_ember backdraft(2)
2:31.088 incinerate Fluffy_Pillow 115215.0/168000: 69% mana | 0.7/4: 18% burning_ember backdraft
2:32.321 incinerate Fluffy_Pillow 109113.1/168000: 65% mana | 0.8/4: 20% burning_ember
2:34.080 incinerate Fluffy_Pillow 100364.1/168000: 60% mana | 0.9/4: 23% burning_ember
2:35.840 incinerate Fluffy_Pillow 91628.2/168000: 55% mana | 1.1/4: 28% burning_ember
2:37.599 conflagrate Fluffy_Pillow 82879.2/168000: 49% mana | 1.3/4: 33% burning_ember
2:38.604 incinerate Fluffy_Pillow 89763.6/168000: 53% mana | 1.5/4: 38% burning_ember backdraft(3)
2:39.836 incinerate Fluffy_Pillow 83648.5/168000: 50% mana | 1.6/4: 40% burning_ember backdraft(2)
2:41.070 incinerate Fluffy_Pillow 77559.9/168000: 46% mana | 1.7/4: 43% burning_ember backdraft
2:42.303 immolate Fluffy_Pillow 71458.0/168000: 43% mana | 1.9/4: 48% burning_ember
2:43.625 incinerate Fluffy_Pillow 69732.6/168000: 42% mana | 2.0/4: 50% burning_ember
2:45.385 incinerate Fluffy_Pillow 60996.8/168000: 36% mana | 2.1/4: 53% burning_ember
2:47.147 incinerate Fluffy_Pillow 52287.4/168000: 31% mana | 2.2/4: 55% burning_ember
2:48.907 incinerate Fluffy_Pillow 43551.6/168000: 26% mana | 2.3/4: 58% burning_ember
2:50.668 conflagrate Fluffy_Pillow 34829.0/168000: 21% mana | 2.4/4: 60% burning_ember
2:51.672 incinerate Fluffy_Pillow 41700.1/168000: 25% mana | 2.5/4: 63% burning_ember backdraft(3)
2:52.905 incinerate Fluffy_Pillow 35598.3/168000: 21% mana | 2.6/4: 65% burning_ember backdraft(2)
2:54.138 incinerate Fluffy_Pillow 29496.4/168000: 18% mana | 2.7/4: 68% burning_ember backdraft
2:55.372 Waiting 0.700 sec 23407.8/168000: 14% mana | 2.8/4: 70% burning_ember
2:56.072 incinerate Fluffy_Pillow 32660.6/168000: 19% mana | 2.8/4: 70% burning_ember
2:57.831 immolate Fluffy_Pillow 23911.5/168000: 14% mana | 2.9/4: 73% burning_ember
2:59.153 Waiting 0.800 sec 22186.1/168000: 13% mana | 2.9/4: 73% burning_ember
2:59.953 incinerate Fluffy_Pillow 32760.7/168000: 20% mana | 2.9/4: 73% burning_ember
3:01.713 conflagrate Fluffy_Pillow 24024.9/168000: 14% mana | 3.1/4: 78% burning_ember
3:02.719 incinerate Fluffy_Pillow 30922.5/168000: 18% mana | 3.2/4: 80% burning_ember backdraft(3)
3:03.952 incinerate Fluffy_Pillow 24820.6/168000: 15% mana | 3.3/4: 83% burning_ember backdraft(2)
3:05.184 Waiting 0.300 sec 18705.6/168000: 11% mana | 3.4/4: 85% burning_ember backdraft
3:05.484 incinerate Fluffy_Pillow 22671.1/168000: 13% mana | 3.4/4: 85% burning_ember backdraft
3:06.715 chaos_bolt Fluffy_Pillow 16542.8/168000: 10% mana | 3.5/4: 88% burning_ember
3:08.911 incinerate Fluffy_Pillow 45570.1/168000: 27% mana | 2.5/4: 63% burning_ember
3:10.671 incinerate Fluffy_Pillow 36834.3/168000: 22% mana | 2.6/4: 65% burning_ember
3:12.429 immolate Fluffy_Pillow 28072.0/168000: 17% mana | 2.8/4: 70% burning_ember
3:13.750 conflagrate Fluffy_Pillow 26333.4/168000: 16% mana | 2.9/4: 73% burning_ember
3:14.755 incinerate Fluffy_Pillow 33217.8/168000: 20% mana | 3.0/4: 75% burning_ember backdraft(3)
3:15.987 incinerate Fluffy_Pillow 27102.7/168000: 16% mana | 3.1/4: 78% burning_ember backdraft(2)
3:17.221 Waiting 0.200 sec 21014.1/168000: 13% mana | 3.2/4: 80% burning_ember backdraft
3:17.421 incinerate Fluffy_Pillow 23657.7/168000: 14% mana | 3.2/4: 80% burning_ember backdraft
3:18.654 Waiting 1.100 sec 17555.9/168000: 10% mana | 3.3/4: 83% burning_ember
3:19.754 incinerate Fluffy_Pillow 32096.0/168000: 19% mana | 3.3/4: 83% burning_ember
3:21.514 chaos_bolt Fluffy_Pillow 23360.2/168000: 14% mana | 3.5/4: 88% burning_ember
3:23.711 incinerate Fluffy_Pillow 52400.7/168000: 31% mana | 2.5/4: 63% burning_ember
3:25.472 conflagrate Fluffy_Pillow 43678.1/168000: 26% mana | 2.7/4: 68% burning_ember
3:26.479 incinerate Fluffy_Pillow 50588.9/168000: 30% mana | 2.9/4: 73% burning_ember backdraft(3)
3:27.711 immolate Fluffy_Pillow 44473.9/168000: 26% mana | 3.1/4: 78% burning_ember backdraft(2)
3:29.032 incinerate Fluffy_Pillow 42735.2/168000: 25% mana | 3.1/4: 78% burning_ember backdraft(2)
3:30.264 incinerate Fluffy_Pillow 36620.1/168000: 22% mana | 3.2/4: 80% burning_ember backdraft
3:31.497 Waiting 0.200 sec 30518.3/168000: 18% mana | 3.3/4: 83% burning_ember
3:31.697 incinerate Fluffy_Pillow 33161.9/168000: 20% mana | 3.3/4: 83% burning_ember
3:33.456 Waiting 0.600 sec 24412.9/168000: 15% mana | 3.4/4: 85% burning_ember
3:34.056 incinerate Fluffy_Pillow 32343.9/168000: 19% mana | 3.4/4: 85% burning_ember
3:35.813 chaos_bolt Fluffy_Pillow 23568.4/168000: 14% mana | 3.5/4: 88% burning_ember
3:38.010 conflagrate Fluffy_Pillow 52609.0/168000: 31% mana | 2.5/4: 63% burning_ember
3:39.016 incinerate Fluffy_Pillow 59506.6/168000: 35% mana | 2.6/4: 65% burning_ember backdraft(3)
3:40.248 incinerate Fluffy_Pillow 53391.5/168000: 32% mana | 2.7/4: 68% burning_ember backdraft(2)
3:41.480 incinerate Fluffy_Pillow 47276.4/168000: 28% mana | 2.9/4: 73% burning_ember backdraft
3:42.712 immolate Fluffy_Pillow 41161.3/168000: 25% mana | 3.1/4: 78% burning_ember
3:44.033 incinerate Fluffy_Pillow 39422.7/168000: 23% mana | 3.2/4: 80% burning_ember
3:45.792 Waiting 0.200 sec 30673.7/168000: 18% mana | 3.3/4: 83% burning_ember
3:45.992 incinerate Fluffy_Pillow 33317.3/168000: 20% mana | 3.3/4: 83% burning_ember
3:47.751 Waiting 0.600 sec 24568.3/168000: 15% mana | 3.4/4: 85% burning_ember
3:48.351 incinerate Fluffy_Pillow 32499.2/168000: 19% mana | 3.4/4: 85% burning_ember
3:50.111 chaos_bolt Fluffy_Pillow 23763.4/168000: 14% mana | 3.5/4: 88% burning_ember
3:52.308 conflagrate Fluffy_Pillow 52804.0/168000: 31% mana | 2.5/4: 63% burning_ember
3:53.313 incinerate Fluffy_Pillow 59688.4/168000: 36% mana | 2.6/4: 65% burning_ember backdraft(3)
3:54.544 incinerate Fluffy_Pillow 53560.1/168000: 32% mana | 2.8/4: 70% burning_ember backdraft(2)
3:55.778 incinerate Fluffy_Pillow 47471.4/168000: 28% mana | 2.9/4: 73% burning_ember backdraft
3:57.010 potion Fluffy_Pillow 41356.4/168000: 25% mana | 3.1/4: 78% burning_ember
3:57.010 immolate Fluffy_Pillow 41356.4/168000: 25% mana | 3.1/4: 78% burning_ember draenic_intellect_potion
3:58.331 incinerate Fluffy_Pillow 39617.7/168000: 24% mana | 3.1/4: 78% burning_ember draenic_intellect_potion
4:00.091 Waiting 0.100 sec 30881.9/168000: 18% mana | 3.3/4: 83% burning_ember draenic_intellect_potion
4:00.191 incinerate Fluffy_Pillow 32203.7/168000: 19% mana | 3.3/4: 83% burning_ember draenic_intellect_potion
4:01.950 dark_soul Fluffy_Pillow 23454.7/168000: 14% mana | 3.5/4: 88% burning_ember draenic_intellect_potion
4:01.950 chaos_bolt Fluffy_Pillow 15454.7/168000: 9% mana | 3.5/4: 88% burning_ember dark_soul, draenic_intellect_potion
4:04.148 chaos_bolt Fluffy_Pillow 44508.5/168000: 26% mana | 2.5/4: 63% burning_ember dark_soul, draenic_intellect_potion
4:06.346 chaos_bolt Fluffy_Pillow 73562.3/168000: 44% mana | 1.6/4: 40% burning_ember dark_soul, draenic_intellect_potion
4:08.543 conflagrate Fluffy_Pillow 102602.8/168000: 61% mana | 0.6/4: 15% burning_ember dark_soul, draenic_intellect_potion
4:09.547 incinerate Fluffy_Pillow 109474.0/168000: 65% mana | 0.8/4: 20% burning_ember backdraft(3), dark_soul, draenic_intellect_potion
4:10.780 chaos_bolt Fluffy_Pillow 103372.1/168000: 62% mana | 1.0/4: 25% burning_ember backdraft(2), dark_soul, draenic_intellect_potion
4:12.978 immolate Fluffy_Pillow 132425.9/168000: 79% mana | 0.0/4: 0% burning_ember backdraft(2), dark_soul, draenic_intellect_potion
4:14.299 conflagrate Fluffy_Pillow 130687.3/168000: 78% mana | 0.1/4: 3% burning_ember backdraft(2), dark_soul, draenic_intellect_potion
4:15.303 incinerate Fluffy_Pillow 137558.4/168000: 82% mana | 0.3/4: 8% burning_ember backdraft(5), dark_soul, draenic_intellect_potion
4:16.537 incinerate Fluffy_Pillow 131469.8/168000: 78% mana | 0.5/4: 13% burning_ember backdraft(4), dark_soul, draenic_intellect_potion
4:17.769 incinerate Fluffy_Pillow 125354.7/168000: 75% mana | 0.6/4: 15% burning_ember backdraft(3), dark_soul, nightmare_fire, draenic_intellect_potion
4:19.002 incinerate Fluffy_Pillow 119252.9/168000: 71% mana | 0.8/4: 20% burning_ember backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
4:20.235 chaos_bolt Fluffy_Pillow 113151.0/168000: 67% mana | 1.0/4: 25% burning_ember backdraft, dark_soul, nightmare_fire, draenic_intellect_potion
4:22.432 incinerate Fluffy_Pillow 142191.6/168000: 85% mana | 0.1/4: 3% burning_ember backdraft, nightmare_fire
4:23.664 incinerate Fluffy_Pillow 136076.5/168000: 81% mana | 0.2/4: 5% burning_ember nightmare_fire
4:25.422 conflagrate Fluffy_Pillow 127314.3/168000: 76% mana | 0.4/4: 10% burning_ember nightmare_fire
4:26.425 incinerate Fluffy_Pillow 134172.2/168000: 80% mana | 0.6/4: 15% burning_ember backdraft(3), nightmare_fire
4:27.656 immolate Fluffy_Pillow 128043.9/168000: 76% mana | 0.7/4: 18% burning_ember backdraft(2), nightmare_fire
4:28.977 incinerate Fluffy_Pillow 126305.3/168000: 75% mana | 0.8/4: 20% burning_ember backdraft(2), nightmare_fire
4:30.209 incinerate Fluffy_Pillow 120190.2/168000: 72% mana | 0.9/4: 23% burning_ember backdraft, nightmare_fire
4:31.442 chaos_bolt Fluffy_Pillow 114088.3/168000: 68% mana | 1.0/4: 25% burning_ember nightmare_fire
4:33.639 incinerate Fluffy_Pillow 143128.9/168000: 85% mana | 0.0/4: 0% burning_ember nightmare_fire
4:35.398 incinerate Fluffy_Pillow 134379.9/168000: 80% mana | 0.1/4: 3% burning_ember nightmare_fire
4:37.158 incinerate Fluffy_Pillow 125644.0/168000: 75% mana | 0.4/4: 10% burning_ember nightmare_fire
4:38.916 conflagrate Fluffy_Pillow 116881.8/168000: 70% mana | 0.5/4: 13% burning_ember
4:39.920 incinerate Fluffy_Pillow 123752.9/168000: 74% mana | 0.6/4: 15% burning_ember backdraft(3)
4:41.153 incinerate Fluffy_Pillow 117651.1/168000: 70% mana | 0.7/4: 18% burning_ember backdraft(2)
4:42.386 immolate Fluffy_Pillow 111549.2/168000: 66% mana | 0.9/4: 23% burning_ember backdraft
4:43.704 incinerate Fluffy_Pillow 109770.9/168000: 65% mana | 0.9/4: 23% burning_ember backdraft
4:44.938 chaos_bolt Fluffy_Pillow 103682.3/168000: 62% mana | 1.1/4: 28% burning_ember
4:47.133 incinerate Fluffy_Pillow 132696.4/168000: 79% mana | 0.1/4: 3% burning_ember
4:48.892 incinerate Fluffy_Pillow 123947.4/168000: 74% mana | 0.2/4: 5% burning_ember
4:50.651 conflagrate Fluffy_Pillow 115198.3/168000: 69% mana | 0.4/4: 10% burning_ember
4:51.655 incinerate Fluffy_Pillow 122069.5/168000: 73% mana | 0.6/4: 15% burning_ember backdraft(3)
4:52.887 incinerate Fluffy_Pillow 115954.4/168000: 69% mana | 0.8/4: 20% burning_ember backdraft(2)
4:54.120 incinerate Fluffy_Pillow 109852.6/168000: 65% mana | 0.9/4: 23% burning_ember backdraft
4:55.352 chaos_bolt Fluffy_Pillow 103737.5/168000: 62% mana | 1.1/4: 28% burning_ember
4:57.549 immolate Fluffy_Pillow 132778.1/168000: 79% mana | 0.1/4: 3% burning_ember

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 573 546 546
Agility 1036 987 987
Stamina 4722 4293 3903
Intellect 4038 3584 3466 (2369)
Spirit 1155 1155 1155
Health 283320 257580 0
Mana 168000 168000 0
Burning Ember 4 4 0
Spell Power 5651 4683 1099
Crit 23.41% 17.45% 1370
Haste 13.95% 8.52% 745
Multistrike 10.97% 5.97% 394
Damage / Heal Versatility 3.60% 0.60% 78
ManaReg per Second 13218 12589 0
Mastery 53.28% 38.28% 524
Armor 633 633 623

Talents

Level
15 Dark Regeneration Soul Leech Searing Flames (Destruction Warlock)
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Horror Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Darkness Kil'jaeden's Cunning Mannoroth's Fury
100 Charred Remains Cataclysm Demonic Servitude

Profile

warlock="Candylicious"
origin="http://eu.battle.net/wow/en/character/forscherliga/Candylicious/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/213/75883733-avatar.jpg"
level=100
race=gnome
role=spell
position=back
professions=tailoring=700/inscription=189
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Vb!1100012
glyphs=siphon_life/havoc/demon_training/nightmares/verdant_spheres
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet,if=!talent.demonic_servitude.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down)
actions.precombat+=/summon_doomguard,if=talent.demonic_servitude.enabled&active_enemies<5
actions.precombat+=/summon_infernal,if=talent.demonic_servitude.enabled&active_enemies>=5
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled&!talent.demonic_servitude.enabled
actions.precombat+=/service_pet,if=talent.grimoire_of_service.enabled
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/incinerate

# Executed every time the actor is available.

actions=potion,name=draenic_intellect,if=buff.bloodlust.react|target.health.pct<=20
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/mannoroths_fury
actions+=/dark_soul,if=!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/summon_doomguard,if=!talent.demonic_servitude.enabled&active_enemies<5
actions+=/summon_infernal,if=!talent.demonic_servitude.enabled&active_enemies>=5
actions+=/run_action_list,name=single_target,if=active_enemies<6
actions+=/run_action_list,name=aoe,if=active_enemies>=6

actions.single_target=havoc,target=2
actions.single_target+=/shadowburn,if=talent.charred_remains.enabled&(burning_ember>=2.5|buff.dark_soul.up|target.time_to_die<10)
actions.single_target+=/cataclysm,if=active_enemies>1
actions.single_target+=/fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=action.immolate.cast_time&(cooldown.cataclysm.remains>action.immolate.cast_time|!talent.cataclysm.enabled)&active_enemies>4
actions.single_target+=/immolate,cycle_targets=1,if=remains<=cast_time&(cooldown.cataclysm.remains>cast_time|!talent.cataclysm.enabled)
actions.single_target+=/cancel_buff,name=fire_and_brimstone,if=buff.fire_and_brimstone.up&dot.immolate.remains>(dot.immolate.duration*0.3)
actions.single_target+=/shadowburn,if=buff.havoc.remains
actions.single_target+=/chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
actions.single_target+=/conflagrate,if=charges=2
actions.single_target+=/cataclysm
actions.single_target+=/rain_of_fire,if=remains<=tick_time&(active_enemies>4|(buff.mannoroths_fury.up&active_enemies>2))
actions.single_target+=/chaos_bolt,if=talent.charred_remains.enabled&active_enemies>1&target.health.pct>20
actions.single_target+=/chaos_bolt,if=talent.charred_remains.enabled&buff.backdraft.stack<3&burning_ember>=2.5
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&(burning_ember>=3.5|buff.dark_soul.up|(burning_ember>=3&buff.ember_master.react)|target.time_to_die<20)
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&set_bonus.tier17_2pc=1&burning_ember>=2.5
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&buff.archmages_greater_incandescence_int.react&buff.archmages_greater_incandescence_int.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.intellect.react>7&trinket.stacking_proc.intellect.remains>=cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.crit.react&trinket.proc.crit.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.multistrike.react>=8&trinket.stacking_proc.multistrike.remains>=cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.multistrike.react&trinket.proc.multistrike.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time
actions.single_target+=/fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=(dot.immolate.duration*0.3)&active_enemies>4
actions.single_target+=/immolate,cycle_targets=1,if=remains<=(duration*0.3)
actions.single_target+=/conflagrate
actions.single_target+=/incinerate

actions.aoe=rain_of_fire,if=remains<=tick_time
actions.aoe+=/havoc,target=2
actions.aoe+=/shadowburn,if=buff.havoc.remains
actions.aoe+=/chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
actions.aoe+=/cataclysm
actions.aoe+=/fire_and_brimstone,if=buff.fire_and_brimstone.down
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&!dot.immolate.ticking
actions.aoe+=/conflagrate,if=buff.fire_and_brimstone.up&charges=2
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&dot.immolate.remains<=(dot.immolate.duration*0.3)
actions.aoe+=/chaos_bolt,if=talent.charred_remains.enabled&buff.fire_and_brimstone.up&burning_ember>=2.5
actions.aoe+=/incinerate

head=crown_of_power,id=118942
neck=odyssian_choker,id=113833,enchant=40crit
shoulders=mantle_of_volatile_ice,id=114517,bonus_id=148/560
back=cloak_of_searing_shadows,id=113847,enchant=gift_of_critical_strike
chest=hexweave_robe,id=114813,bonus_id=59/525/537
tabard=gnomeregan_tabard,id=45578
wrists=rotmonger_bracers,id=115999
hands=meatmongers_gory_grips,id=113610
waist=cord_of_winsome_sorrows,id=119336
legs=hexweave_leggings,id=114811,bonus_id=34/526/537
feet=sandals_of_volatile_ice,id=114501,bonus_id=37
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=30crit
finger2=kargaths_last_link,id=113604,bonus_id=566,enchant=50crit
trinket1=sandmans_pouch,id=112320,bonus_id=525/529
trinket2=grandiose_power,id=114550,bonus_id=40/563,gems=50crit
main_hand=meganas_staff_of_knowledge,id=115423,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_stamina=3013
# gear_intellect=2369
# gear_spell_power=1099
# gear_crit_rating=1305
# gear_haste_rating=745
# gear_mastery_rating=524
# gear_armor=623
# gear_multistrike_rating=394
# gear_versatility_rating=78
# gear_avoidance_rating=82
default_pet=felhunter

Dârkride

Dârkride : 22247 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22246.7 22246.7 7.9 / 0.035% 2465.9 / 11.1% 2604.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.5 Rage 0.00% 92.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Dârkride/advanced
Talents
  • 15: Double Time
  • 30: Enraged Regeneration
  • 45: Unyielding Strikes (Protection Warrior)
  • 60: Dragon Roar
  • 75: Vigilance
  • 90: Bloodbath
  • 100: Gladiator's Resolve (Protection Warrior)
  • Talent Calculator
Glyphs
  • Glyph of Enraged Speed
  • Glyph of Cleave
  • Glyph of Bull Rush
  • Glyph of Gushing Wound
  • Glyph of Bloodcurdling Shout
  • Glyph of Mystic Shout
Professions
  • mining: 700
  • blacksmithing: 666

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=D%C3%A2rkride+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:22909|22899|15566|14150|8298|2467&chds=0,45818&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++22909++execute,C79C6E,0,0,15|t++22899++dragon_roar,C79C6E,1,0,15|t++15566++shield_slam,C79C6E,2,0,15|t++14150++revenge,C79C6E,3,0,15|t++8298++devastate,C79C6E,4,0,15|t++2467++auto_attack_mh,C79C6E,5,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=D%C3%A2rkride+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:20,20,18,11,9,8,6,3,2,2,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=shield_slam|devastate|heroic_strike|auto_attack_mh|deep_wounds|revenge|bloodbath|execute|dragon_roar|shattered_bleed|heroic_leap&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=D%C3%A2rkride+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:hkorsvz158663331zzywvtrqronljjjiihgghffffeddddddcbccbfghgjjkjlmlmpporsrpsppnnmkjkjgihgefedcdcbZbbacccacbcbbcaabcadeedffgfghggijhkkkijjighgfdffdeddbdccabbaabbabcbabbbabbaZbbZccdcdeddefdeggfghhfhgfeefcdddbcdcbcbaabbabbcacccaccabbcacddbdfeeggggiihjjkillkjkjhhihgggfdfedbdcbbccbcccbcdcbdcbbccbccdbddcceedefgfghhghhggihggggefffdeeccdcccddbccdbdcbbcdbdcdccddceeddfeefeeccaYWWUSQQN&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.553403,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=22247|max=40200&chxp=1,1,55,100 Resolve Timeline Chart http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=D%C3%A2rkride+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,4,13,15,28,53,90,150,207,303,391,578,745,909,1073,1224,1379,1477,1498,1584,1581,1620,1413,1349,1262,1129,940,825,692,563,464,396,287,210,158,119,75,57,53,32,18,10,8,3,4,5,0,1,0,2&chds=0,1620&chbh=5&chxt=x&chxl=0:|min=20143|avg=22247|max=25216&chxp=0,1,41,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=D%C3%A2rkride+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:52.5,29.2,13.2,3.0,2.3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=devastate 158.0s|shield_slam 87.9s|revenge 39.7s|execute 9.0s|dragon_roar 7.0s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Dârkride 22247
auto_attack_mh 2465 11.1% 133.3 2.27sec 5553 2467 Direct 133.3 4466 9034 5339 19.1% 17.8 1340 2711 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.32 133.32 0.00 0.00 2.2505 0.0000 740268.52 1137675.84 34.93 2467.19 2467.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.40 19.09% 2710.58 2374 3417 2619.19 0 3417 9216 14163 33.73
multistrike 14.41 80.91% 1340.03 1187 1708 1341.04 1207 1628 19308 29674 34.93
hit 107.86 80.90% 4466.15 3956 5694 4469.70 4313 4646 481714 740319 34.93
crit 25.46 19.10% 9034.17 7913 11389 9042.58 8264 10204 230030 353520 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
bloodbath 1265 5.7% 5.5 60.04sec 68629 0 Periodic 92.1 4115 0 4115 0.0% 0.0 0 0 0.0% 30.6%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.52 5.52 92.12 92.12 0.0000 1.0000 379068.11 379068.11 0.00 4115.12 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.1 100.00% 4115.09 388 11557 4125.11 3253 5322 379068 379068 0.00
 
DPS Timeline Chart
 

Action details: bloodbath

Static Values
  • id:113344
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc12292=For the next {$12292d=12 seconds}, your melee damage abilities and their multistrikes deal {$12292s1=30}% additional damage as a bleed over {$113344d=6 seconds}. While bleeding, targets move {$147531s1=50}% slower.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
deep_wounds 1963 8.8% 120.8 2.47sec 4889 0 Periodic 98.7 4828 9736 5753 18.8% 13.2 1448 2919 18.9% 98.4%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.75 120.75 98.65 98.65 0.0000 3.0000 590309.57 590309.57 0.00 1994.61 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.5 18.87% 2919.34 2567 3823 2666.51 0 3823 7270 7270 0.00
multistrike 10.7 81.13% 1448.23 1283 1912 1449.70 0 1912 15508 15508 0.00
hit 80.1 81.15% 4828.03 4278 6372 4832.36 4627 5034 386532 386532 0.00
crit 18.6 18.85% 9735.80 8556 12744 9745.24 8800 11621 181000 181000 0.00
 
DPS Timeline Chart
 

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Cancelled if target reaches full health.
  • description:Your Mortal Strike, Bloodthirst, Devastate, and Thunder Clap cause the target to bleed for $115767o1 Physical damage over {$115767d=15 seconds}. This effect is cancelled if the target reaches full health.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.600000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
devastate 4365 19.6% 120.8 2.47sec 10857 8298 Direct 120.8 8731 17700 10439 19.0% 16.1 2619 5313 19.0%  

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.75 120.75 0.00 0.00 1.3083 0.0000 1310966.22 2014748.08 34.93 8298.41 8298.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.06 19.01% 5313.13 4652 6679 5050.27 0 6679 16255 24981 33.18
multistrike 13.03 80.99% 2619.14 2326 3339 2621.15 0 3166 34128 52449 34.93
hit 97.76 80.95% 8731.06 7754 11131 8739.32 8400 9106 853515 1311717 34.93
crit 23.00 19.05% 17700.46 15507 22262 17707.92 16024 19954 407069 625600 34.93
 
DPS Timeline Chart
 

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:Deals $sw1 Physical damage, and has a {$46953s1=30}% chance to reset the cooldown on Shield Slam and cause it to generate $/10;50227s1 more Rage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
dragon_roar 536 2.4% 5.4 61.13sec 29905 22899 Direct 5.4 0 28756 28756 100.0% 0.7 0 8630 100.0%  

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 5.37 0.00 0.00 1.3060 0.0000 160569.50 160569.50 0.00 22899.24 22899.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.71 100.00% 8629.91 7057 10511 4491.35 0 10511 6168 6168 0.00
crit 5.37 100.00% 28756.48 23522 35038 28813.95 26693 30456 154402 154402 0.00
 
DPS Timeline Chart
 

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:
  • description:Roar explosively, dealing {$?s12712=false}[${$m1*1.25}][$m1] damage to all enemies within $A1 yards and knocking them back and down for {$118895d=500 milliseconds}. Damage ignores all armor and is always a critical strike.
 
execute 686 3.1% 6.6 7.92sec 31257 22909 Direct 6.6 25398 50871 30050 18.3% 0.9 7618 15254 18.2%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.62 6.62 0.00 0.00 1.3645 0.0000 206938.74 318032.17 34.93 22909.19 22909.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.16 18.21% 15253.67 14178 15596 2287.29 0 15596 2463 3785 5.24
multistrike 0.73 81.79% 7618.31 7089 7798 3938.26 0 7798 5524 8489 18.06
hit 5.41 81.74% 25398.23 23630 25993 25389.98 0 25993 137444 211230 34.92
crit 1.21 18.26% 50871.28 47260 51986 36873.37 0 51986 61508 94527 25.32
 
DPS Timeline Chart
 

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.sudden_death.react
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing $sw2 Physical damage{$?s23881=false}[ with your main-hand and $163558sw2 Physical damage with your off-hand][]. Only usable on enemies that have less than 20% health.{$?s146971=false}[ Successfully killing an enemy with Execute grants you {$147352s1=300 + 100.0%} rage.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
heroic_leap 78 0.4% 6.9 46.03sec 3424 0 Direct 6.9 2729 5634 3293 19.4% 0.9 818 1679 19.9%  

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.86 0.00 0.00 0.0000 0.0000 23509.42 36130.26 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.18 19.92% 1678.57 1447 2156 284.91 0 2156 310 476 5.93
multistrike 0.74 80.08% 818.47 724 1078 434.93 0 1078 607 933 18.57
hit 5.53 80.58% 2728.93 2412 3593 2728.73 0 3593 15086 23185 34.93
crit 1.33 19.42% 5633.79 4823 7185 4365.78 0 7185 7506 11536 26.98
 
DPS Timeline Chart
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a targeted location, slamming down with destructive force to deal {$?s12712=false}[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
 
heroic_strike 4053 18.2% 187.0 1.61sec 6506 0 Direct 187.0 4978 10189 6255 24.5% 25.0 1493 3058 24.5%  

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 187.05 187.05 0.00 0.00 0.0000 0.0000 1216857.13 1870117.27 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.13 24.52% 3057.55 2326 4173 3052.82 0 4173 18741 28802 34.84
multistrike 18.86 75.48% 1493.23 1163 2087 1494.46 1279 1825 28170 43292 34.93
hit 141.21 75.50% 4977.64 3876 6956 4982.03 4756 5282 702910 1080262 34.93
crit 45.84 24.50% 10189.46 7752 13911 10198.99 9172 11486 467036 717761 34.93
 
DPS Timeline Chart
 

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:
  • description:Instantly deals $sw2 Physical damage{$?s58366=false}[, reducing the target's movement speed by {$129923s1=50}% for {$129923d=8 seconds}][]. This ability is not on the global cooldown.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.05
 
revenge 1870 8.4% 30.2 10.09sec 18621 14150 Direct 30.2 14999 30299 17903 19.0% 4.0 4500 9102 18.9%  

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.17 30.17 0.00 0.00 1.3160 0.0000 561807.72 863409.76 34.93 14149.55 14149.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.76 18.88% 9101.78 7013 13058 4849.78 0 13058 6930 10651 18.60
multistrike 3.27 81.12% 4499.55 3507 6529 4333.33 0 6529 14719 22620 33.62
hit 24.44 81.01% 14998.52 11688 21764 15012.38 13393 16877 366604 563412 34.93
crit 5.73 18.99% 30299.23 23377 43527 30280.05 0 43527 173555 266726 34.85
 
DPS Timeline Chart
 

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Instantly attack an enemy and two additional enemies, dealing {$s1=1} damage to the primary target and {$s3=50}% damage to the secondary targets, and generating {$/10;s2=20} Rage. Your successful dodges and parries reset the cooldown on Revenge.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.520000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shattered_bleed 410 1.8% 16.9 18.21sec 7268 0 Direct 16.9 2076 4159 2471 19.0% 2.3 623 1247 18.8%  
Periodic 96.1 796 0 796 0.0% 12.9 243 0 0.0% 31.9%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.95 16.95 96.07 96.07 0.0000 1.0000 123190.39 123190.39 0.00 1282.32 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.43 18.78% 1247.44 1165 1281 432.19 0 1281 535 535 0.00
multistrike 1.86 81.22% 623.12 582 641 522.39 0 641 1156 1156 0.00
hit 13.74 81.04% 2076.40 1941 2135 2075.99 1965 2135 28520 28520 0.00
crit 3.21 18.96% 4159.01 3882 4270 4005.51 0 4270 13366 13366 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 12.9 100.00% 242.62 243 243 242.62 243 243 3118 3118 0.00
hit 96.1 100.00% 796.26 0 809 796.64 768 809 76495 76495 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shield_slam 4556 20.5% 66.9 4.52sec 20456 15566 Direct 66.9 16423 33400 19668 19.1% 8.9 4930 10019 19.0%  

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.87 66.87 0.00 0.00 1.3142 0.0000 1367834.50 2102145.65 34.93 15565.86 15565.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.70 18.96% 10019.44 7434 13842 8148.26 0 13842 16985 26103 28.39
multistrike 7.25 81.04% 4929.67 3717 6921 4929.82 0 6921 35726 54906 34.90
hit 54.09 80.89% 16423.09 12390 23069 16442.38 15416 17625 888265 1365123 34.93
crit 12.78 19.11% 33399.69 24779 46139 33420.23 26431 41312 426858 656014 34.93
 
DPS Timeline Chart
 

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slam the target with your shield, causing ${$<shieldslam>} damage{$?s58375=false}[, dispelling 1 magical effect,][] and generating {$/10;s3=20} Rage. Critical strikes with Shield Slam cause your next Heroic Strike to cost no Rage and be a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.671200
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Dârkride
berserker_rage 9.1 34.51sec

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.11 9.11 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.down
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You go berserk, removing and granting immunity to Fear, Sap and Incapacitate effects for {$d=6 seconds}.
 
blood_craze 17.8 16.23sec

Stats details: blood_craze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 17.81 0.00 51.15 51.15 0.0000 1.0000 0.00 137261.37 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.2 100.00% 0.00 0 0 0.00 0 0 0 137261 100.00
 
HPS Timeline Chart
 

Action details: blood_craze

Static Values
  • id:159362
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dârkride
  • harmful:false
  • if_expr:
Spelldata
  • id:159362
  • name:Blood Craze
  • school:physical
  • tooltip:
  • description:Your multistrikes from auto attacks trigger a Blood Craze. Blood Craze regenerates {$s1=3}% of your health over {$159363d=3 seconds}. When this effect is refreshed, the remaining portion is added to the new effect.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.83 83.32% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.17 16.68% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it {$?s58377=false}[and {$58377s1=2} additional nearby targets ][]for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. Generates {$/10;s2=20} Rage.
 
draenic_armor_potion 2.0 0.00sec

Stats details: draenic_armor_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156430
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156430
  • name:Draenic Armor Potion
  • school:physical
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
 
shield_charge 21.3 14.53sec

Stats details: shield_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.25 21.25 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shield_charge

Static Values
  • id:156321
  • school:physical
  • resource:rage
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
Spelldata
  • id:156321
  • name:Shield Charge
  • school:physical
  • tooltip:
  • description:Raise your shield and charge a short distance to your target, increasing the damage of Shield Slam, Revenge, and Heroic Strike by {$169667s1=25}% for {$169667d=7 seconds}. Maximum 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
berserker_rage 9.1 0.0 34.9sec 34.5sec 18.01% 18.02% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserker_rage_1:18.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You go berserk, removing and granting immunity to Fear, Sap and Incapacitate effects for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
blood_craze 15.0 2.8 19.3sec 16.1sec 16.55% 16.56% 2.8(2.8)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_blood_craze
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • blood_craze_1:16.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159363
  • name:Blood Craze
  • tooltip:Regenerating $w1 health every $t1 sec.
  • description:{$@spelldesc159362=Your multistrikes from auto attacks trigger a Blood Craze. Blood Craze regenerates {$s1=3}% of your health over {$159363d=3 seconds}. When this effect is refreshed, the remaining portion is added to the new effect.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
bloodbath 5.5 0.0 60.1sec 60.0sec 21.56% 21.63% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodbath_1:21.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks and their multistrikes cause an additional {$12292s1=30}% bleed damage.
  • description:For the next {$12292d=12 seconds}, your melee damage abilities and their multistrikes deal {$12292s1=30}% additional damage as a bleed over {$113344d=6 seconds}. While bleeding, targets move {$147531s1=50}% slower.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_armor_potion 2.0 0.0 59.9sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_draenic_armor_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:bonus_armor
  • amount:1500.00

Stack Uptimes

  • draenic_armor_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156430
  • name:Draenic Armor Potion
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enrage 17.8 27.1 17.3sec 6.8sec 76.81% 69.87% 27.1(27.1)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enrage_1:76.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Damage dealt increased by {$s2=10}%.$?$w5!=0[ Movement speed increased by $w5%.][]
  • description:{$@spelldesc13046={$?s23881=false}[Bloodthirst critical strikes][Shield Slam and Devastate critical strikes, critical blocks,] and activating Berserker Rage will Enrage you, generating ${$12880m1/10} Rage and increasing damage done by {$12880s2=10}% for {$12880d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
enraged_speed (enraged_speed) 17.8 27.1 17.3sec 6.8sec 76.81% 76.81% 27.1(27.1)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_enraged_speed
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enraged_speed_1:76.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58355
  • name:Glyph of Enraged Speed
  • tooltip:
  • description:While Enraged, you move {$58355s1=20}% faster.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shield_charge 21.3 0.0 14.4sec 14.5sec 49.11% 57.07% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_shield_charge
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shield_charge_1:49.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:169667
  • name:Shield Charge
  • tooltip:Increases damage done by your Shield Slam, Revenge, and Heroic Strike abilities by {$s1=25}%.
  • description:{$@spelldesc156321=Raise your shield and charge a short distance to your target, increasing the damage of Shield Slam, Revenge, and Heroic Strike by {$169667s1=25}% for {$169667d=7 seconds}. Maximum 2 charges.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.1 0.0 117.9sec 117.9sec 19.76% 19.78% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
sword_and_board 36.2 0.0 8.1sec 8.1sec 15.69% 53.78% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_sword_and_board
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • sword_and_board_1:15.69%

Trigger Attempt Success

  • trigger_pct:30.01%

Spelldata details

  • id:50227
  • name:Sword and Board
  • tooltip:Shield Slam generates $/10;50227s1 more Rage.
  • description:Your Devastate has a {$s1=50}% chance of resetting the cooldown of your Shield Slam and increasing the Rage it generates by $/10;50227s1 for {$50227d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
ultimatum 12.8 0.0 22.5sec 22.7sec 2.81% 2.82% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_ultimatum
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ultimatum_1:2.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:122510
  • name:Ultimatum
  • tooltip:Your next Heroic Strike costs no Rage and is a critical strike.
  • description:{$@spelldesc122509=Your Shield Slam criticals make your next Heroic Strike cost no Rage and be a guaranteed critical strike.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
unyielding_strikes 16.6 81.2 18.4sec 3.1sec 92.88% 91.83% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_unyielding_strikes
  • max_stacks:6
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-5.00

Stack Uptimes

  • unyielding_strikes_1:13.48%
  • unyielding_strikes_2:13.23%
  • unyielding_strikes_3:12.53%
  • unyielding_strikes_4:13.48%
  • unyielding_strikes_5:13.84%
  • unyielding_strikes_6:26.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:169686
  • name:Unyielding Strikes
  • tooltip:Heroic Strike cost reduced by ${$m1/-10}.
  • description:
  • max_stacks:6
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
gladiator_stance

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_gladiator_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • gladiator_stance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156291
  • name:Gladiator Stance
  • tooltip:An offensive stance that trades all defensive prowess for increase damage dealing. Physical damage dealt increased by {$s1=20}%. Your Shield Block is replaced with Shield Charge.
  • description:A dauntless combat stance. Increases physical damage dealt by {$s1=20}%, and replaces your Shield Block with Shield Charge. You cannot change into or out of this stance during combat.
  • max_stacks:0
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
resolve

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_resolve
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • resolve_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Custom Section

Dârkride

Overall DPS

22246.67

Percentage of damage dealt to primary target

%100.00

Dps done to primary target

22246.67

DPS occuring inside of shield charge + benefiting from shield charge

6841.75

Percentage of overall damage

30.75

Resources

Resource Usage Type Count Total Average RPE APR
Dârkride
execute Rage 6.6 198.6 30.0 30.0 1041.9
heroic_strike Rage 187.0 1941.4 10.4 10.4 626.8
shield_charge Rage 21.3 425.0 20.0 20.0 0.0
Resource Gains Type Count Total Average Overflow
blood_craze Health 51.15 0.00 (0.00%) 0.00 137259.07 100.00%
external_healing Health 8.77 0.00 (0.00%) 0.00 81131.82 100.00%
charge Rage 1.00 35.00 (1.35%) 35.00 0.00 0.00%
enrage Rage 44.89 447.58 (17.25%) 9.97 1.31 0.29%
revenge Rage 30.17 599.67 (23.11%) 19.88 3.74 0.62%
shield_slam Rage 66.87 1334.77 (51.43%) 19.96 2.56 0.19%
sword_and_board Rage 36.03 178.25 (6.87%) 4.95 1.88 1.04%
Resource RPS-Gain RPS-Loss
Rage 8.62 8.52
Combat End Resource Mean Min Max
Rage 30.37 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.7%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Dârkride Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Dârkride Damage Per Second
Count 25000
Mean 22246.67
Minimum 20143.42
Maximum 25215.88
Spread ( max - min ) 5072.46
Range [ ( max - min ) / 2 * 100% ] 11.40%
Standard Deviation 634.0604
5th Percentile 21257.66
95th Percentile 23334.88
( 95th Percentile - 5th Percentile ) 2077.22
Mean Distribution
Standard Deviation 4.0101
95.00% Confidence Intervall ( 22238.81 - 22254.53 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3120
0.1 Scale Factor Error with Delta=300 3431
0.05 Scale Factor Error with Delta=300 13727
0.01 Scale Factor Error with Delta=300 343198
Distribution Chart
DPS(e)
Sample Data Dârkride Damage Per Second (Effective)
Count 25000
Mean 22246.67
Minimum 20143.42
Maximum 25215.88
Spread ( max - min ) 5072.46
Range [ ( max - min ) / 2 * 100% ] 11.40%
Damage
Sample Data Dârkride Damage
Count 25000
Mean 6681319.81
Minimum 4862056.13
Maximum 8603281.25
Spread ( max - min ) 3741225.11
Range [ ( max - min ) / 2 * 100% ] 28.00%
DTPS
Sample Data Dârkride Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Dârkride Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Dârkride Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Dârkride Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Dârkride Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Dârkride Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data DârkrideTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Dârkride Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 stance,choose=gladiator
talent_override=bladestorm,if=raid_event.adds.count>1|desired_targets>2|(raid_event.adds.duration<10&raid_event.adds.exists) talent_override=dragon_roar,if=raid_event.adds.count>=1|desired_targets>1
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done. # Generic on-use trinket line if needed when swapping trinkets out. #actions+=/use_item,slot=trinket1,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
4 0.00 potion,name=draenic_armor
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 0.00 call_action_list,name=movement,if=movement.distance>5
This is mostly to prevent cooldowns from being accidentally used during movement.
8 0.00 avatar
9 5.52 bloodbath
A 0.00 blood_fury,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
B 0.00 berserking,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
C 0.00 arcane_torrent,if=rage<rage.max-40
D 1.00 potion,name=draenic_armor,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up
E 21.25 shield_charge,if=(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
F 9.11 berserker_rage,if=buff.enrage.down
G 6.87 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
H 146.39 heroic_strike,if=(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
I 40.66 heroic_strike,if=buff.ultimatum.up|rage>=rage.max-20|buff.unyielding_strikes.stack>4|target.time_to_die<10
J 0.00 call_action_list,name=single,if=active_enemies=1
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
actions.single
# count action,conditions
P 19.71 devastate,if=buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
Q 66.87 shield_slam
R 30.17 revenge
S 0.00 execute,if=buff.sudden_death.react
T 0.00 storm_bolt
U 5.37 dragon_roar
V 6.62 execute,if=rage>60&target.health.pct<20
W 101.04 devastate

Sample Sequence

014569EFQHRHUWWQHHWGWWIIQHRHWHWEHQHWHWHWQHWRHWQHHWHWIWIQHWHWHREFHQHWQHWQHHWWEHQHHRHWHQHWHWHWEHQHWHRHWQHWGWWIIQHR9DHPEHQHUHWHWHQFHRPHWQHHWHWEQHHRHPHWHQHWWHHQHRHPWEQHWHWWHHQFHRGHWQWHHQHWWRHEQHHPQHHWHWHWIQHR9WHWEQHUPHWQHHRHPHQHWHWFHWEHQHRHWHQHWGWWQHRHHPIWIQHWHWWEQHRHPWQHWFHWIWIQHRHWWHEQHWWW9QHHRPHIUIQHPHWGHWEHQHRHWHWQHWHQHWEQHHRHPHWHQHWEHQHWFHRWHQHWWWIIQIRHPHWEHQHWHQHWRHWGQIWWWI9EIQIRFIPIQIUIVWQIRIPWEQWWIIWIQIRIVVQWWVEQPRWQIVGPIIQIWFIRIVEIQIWIWWQIRIPIIWQI

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 0.0/100: 0% rage
Pre food Fluffy_Pillow 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% rage draenic_armor_potion
0:00.000 charge Fluffy_Pillow 0.0/100: 0% rage draenic_armor_potion
0:00.000 auto_attack Fluffy_Pillow 35.0/100: 35% rage spirit_of_the_warlords, draenic_armor_potion
0:00.000 bloodbath Fluffy_Pillow 35.0/100: 35% rage spirit_of_the_warlords, draenic_armor_potion
0:00.000 shield_charge Fluffy_Pillow 35.0/100: 35% rage bloodbath, spirit_of_the_warlords, draenic_armor_potion
0:00.000 berserker_rage Fluffy_Pillow 15.0/100: 15% rage bloodbath, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:00.000 shield_slam Fluffy_Pillow 25.0/100: 25% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:00.000 heroic_strike Fluffy_Pillow 15.0/100: 15% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:01.365 revenge Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:01.365 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:02.416 dragon_roar Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:03.466 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:04.516 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:05.564 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:05.564 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:06.617 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:06.617 devastate Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:07.668 heroic_leap Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords, draenic_armor_potion
0:07.668 devastate Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords, draenic_armor_potion
0:08.719 devastate Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords, draenic_armor_potion
0:08.719 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:09.770 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:09.770 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:10.821 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), ultimatum, spirit_of_the_warlords, draenic_armor_potion
0:10.821 revenge Fluffy_Pillow 30.0/100: 30% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:11.871 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:11.871 devastate Fluffy_Pillow 45.0/100: 45% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:12.922 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:12.922 devastate Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:13.973 shield_charge Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:13.973 heroic_strike Fluffy_Pillow 25.0/100: 25% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:13.973 shield_slam Fluffy_Pillow 25.0/100: 25% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:15.025 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:15.025 devastate Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:16.076 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:16.076 devastate Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:17.126 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:17.126 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:18.178 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodlust, shield_charge, sword_and_board, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:18.178 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodlust, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:19.228 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:20.279 revenge Fluffy_Pillow 15.0/100: 15% rage bloodlust, shield_charge, unyielding_strikes(2)
0:20.279 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodlust, shield_charge, unyielding_strikes(2)
0:21.327 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, unyielding_strikes(2)
0:22.377 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodlust, unyielding_strikes(3)
0:22.377 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, unyielding_strikes(3)
0:23.427 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, unyielding_strikes(3)
0:23.427 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, unyielding_strikes(3)
0:24.478 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:24.478 devastate Fluffy_Pillow 20.0/100: 20% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:25.528 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodlust, enrage, enraged_speed, unyielding_strikes(5)
0:25.528 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, enrage, enraged_speed, unyielding_strikes(5)
0:26.579 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodlust, blood_craze, enrage, enraged_speed, unyielding_strikes(6)
0:26.579 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodlust, blood_craze, enrage, enraged_speed, unyielding_strikes(6)
0:27.629 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, blood_craze, enrage, enraged_speed, unyielding_strikes(6)
0:27.629 devastate Fluffy_Pillow 35.0/100: 35% rage bloodlust, blood_craze, enrage, enraged_speed, unyielding_strikes(6)
0:28.680 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:28.680 devastate Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:29.731 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:29.731 revenge Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:30.031 shield_charge Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:30.780 berserker_rage Fluffy_Pillow 35.0/100: 35% rage bloodlust, shield_charge
0:30.780 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge
0:30.780 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge
0:31.830 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge
0:31.830 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge
0:32.880 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
0:32.880 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
0:33.931 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
0:34.981 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
0:34.981 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:36.030 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:36.030 devastate Fluffy_Pillow 20.0/100: 20% rage bloodlust, berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:37.081 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, blood_craze, enrage, enraged_speed, unyielding_strikes(3)
0:37.081 shield_charge Fluffy_Pillow 10.0/100: 10% rage bloodlust, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
0:37.081 heroic_strike Fluffy_Pillow 0.0/100: 0% rage bloodlust, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
0:38.132 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
0:38.132 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:39.181 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:39.181 revenge Fluffy_Pillow 25.0/100: 25% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:40.233 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:40.233 devastate Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:41.283 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5)
0:41.283 shield_slam Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5)
0:42.647 heroic_strike Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
0:42.647 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
0:44.011 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:44.011 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:45.375 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(6)
0:45.375 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(6)
0:46.740 shield_charge Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(6)
0:46.740 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:46.740 shield_slam Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:48.105 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, shield_charge
0:48.105 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge
0:49.470 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes
0:49.470 revenge Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes
0:50.835 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes
0:50.835 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes
0:52.199 shield_slam Fluffy_Pillow 10.0/100: 10% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:52.199 heroic_strike Fluffy_Pillow 10.0/100: 10% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:53.563 devastate Fluffy_Pillow 10.0/100: 10% rage blood_craze, shield_charge, unyielding_strikes(2)
0:54.928 heroic_leap Fluffy_Pillow 10.0/100: 10% rage blood_craze, unyielding_strikes(3)
0:54.928 devastate Fluffy_Pillow 10.0/100: 10% rage blood_craze, unyielding_strikes(3)
0:56.292 devastate Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes(4)
0:56.292 heroic_strike Fluffy_Pillow 15.0/100: 15% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5)
0:57.658 heroic_strike Fluffy_Pillow 15.0/100: 15% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5)
0:57.658 shield_slam Fluffy_Pillow 10.0/100: 10% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5)
0:59.021 heroic_strike Fluffy_Pillow 40.0/100: 40% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5), ultimatum
0:59.021 revenge Fluffy_Pillow 40.0/100: 40% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5)
1:00.386 bloodbath Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(5)
1:00.386 potion Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes(5)
1:00.386 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes(5), draenic_armor_potion
1:00.386 devastate Fluffy_Pillow 55.0/100: 55% rage bloodbath, enrage, enraged_speed, unyielding_strikes(5), draenic_armor_potion
1:00.386 shield_charge Fluffy_Pillow 45.0/100: 45% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:01.750 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:01.750 shield_slam Fluffy_Pillow 45.0/100: 45% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:03.114 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:03.114 dragon_roar Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:04.477 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:04.477 devastate Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:05.842 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, draenic_armor_potion
1:05.842 devastate Fluffy_Pillow 40.0/100: 40% rage bloodbath, enrage, enraged_speed, shield_charge, draenic_armor_potion
1:07.208 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes, draenic_armor_potion
1:07.208 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes, draenic_armor_potion
1:08.572 berserker_rage Fluffy_Pillow 35.0/100: 35% rage bloodbath, unyielding_strikes, draenic_armor_potion
1:08.572 heroic_strike Fluffy_Pillow 45.0/100: 45% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes, draenic_armor_potion
1:08.572 revenge Fluffy_Pillow 20.0/100: 20% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes, draenic_armor_potion
1:09.937 devastate Fluffy_Pillow 40.0/100: 40% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes, draenic_armor_potion
1:09.937 heroic_strike Fluffy_Pillow 30.0/100: 30% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(2), draenic_armor_potion
1:11.301 devastate Fluffy_Pillow 30.0/100: 30% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(2), draenic_armor_potion
1:12.665 shield_slam Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3), draenic_armor_potion
1:12.665 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3), draenic_armor_potion
1:14.031 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3), draenic_armor_potion
1:14.031 devastate Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3), draenic_armor_potion
1:15.396 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:15.396 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:15.396 shield_charge Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), draenic_armor_potion
1:16.761 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), draenic_armor_potion
1:16.761 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:18.124 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:18.124 revenge Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:19.489 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:19.489 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:20.855 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:20.855 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:22.219 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:22.219 shield_slam Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:23.582 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(6), draenic_armor_potion
1:23.582 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(6), draenic_armor_potion
1:24.948 devastate Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, draenic_armor_potion
1:24.948 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, sword_and_board, unyielding_strikes, draenic_armor_potion
1:26.313 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, sword_and_board, unyielding_strikes
1:26.313 shield_slam Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, sword_and_board, unyielding_strikes
1:27.678 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes
1:27.678 revenge Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes
1:29.043 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes
1:29.043 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes
1:30.408 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(2)
1:31.772 shield_charge Fluffy_Pillow 25.0/100: 25% rage blood_craze, enrage, enraged_speed, unyielding_strikes(3)
1:31.772 shield_slam Fluffy_Pillow 5.0/100: 5% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:31.772 heroic_strike Fluffy_Pillow 10.0/100: 10% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:33.138 devastate Fluffy_Pillow 10.0/100: 10% rage blood_craze, shield_charge, unyielding_strikes(3)
1:33.138 heroic_strike Fluffy_Pillow 0.0/100: 0% rage blood_craze, shield_charge, unyielding_strikes(4)
1:34.503 devastate Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(4)
1:35.866 devastate Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(5)
1:35.866 heroic_strike Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(6)
1:37.231 heroic_strike Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(6)
1:37.231 shield_slam Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(6)
1:38.595 berserker_rage Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes(6)
1:38.595 heroic_strike Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
1:38.595 revenge Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
1:39.960 heroic_leap Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
1:39.960 heroic_strike Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
1:39.960 devastate Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
1:41.324 shield_slam Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, sword_and_board
1:42.688 devastate Fluffy_Pillow 75.0/100: 75% rage berserker_rage, enrage, enraged_speed
1:42.688 heroic_strike Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes
1:44.052 heroic_strike Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes
1:44.052 shield_slam Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes
1:45.418 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes
1:45.418 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes
1:46.782 devastate Fluffy_Pillow 25.0/100: 25% rage unyielding_strikes(2)
1:48.147 revenge Fluffy_Pillow 25.0/100: 25% rage blood_craze, unyielding_strikes(3)
1:48.147 heroic_strike Fluffy_Pillow 30.0/100: 30% rage blood_craze, unyielding_strikes(3)
1:49.511 shield_charge Fluffy_Pillow 30.0/100: 30% rage blood_craze, unyielding_strikes(3)
1:49.511 shield_slam Fluffy_Pillow 10.0/100: 10% rage blood_craze, shield_charge, unyielding_strikes(3)
1:49.511 heroic_strike Fluffy_Pillow 15.0/100: 15% rage blood_craze, shield_charge, unyielding_strikes(3)
1:50.878 heroic_strike Fluffy_Pillow 15.0/100: 15% rage blood_craze, shield_charge, unyielding_strikes(3)
1:50.878 devastate Fluffy_Pillow 0.0/100: 0% rage blood_craze, shield_charge, unyielding_strikes(3)
1:52.244 shield_slam Fluffy_Pillow 0.0/100: 0% rage shield_charge, sword_and_board, unyielding_strikes(4)
1:52.244 heroic_strike Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes(4)
1:53.609 heroic_strike Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes(4)
1:53.609 devastate Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(4)
1:54.976 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
1:54.976 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
1:56.339 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
1:56.339 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
1:57.704 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
1:57.704 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
1:59.069 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
1:59.069 revenge Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:00.433 bloodbath Fluffy_Pillow 50.0/100: 50% rage blood_craze, enrage, enraged_speed, spirit_of_the_warlords
2:00.433 devastate Fluffy_Pillow 50.0/100: 50% rage bloodbath, blood_craze, enrage, enraged_speed, spirit_of_the_warlords
2:00.433 heroic_strike Fluffy_Pillow 25.0/100: 25% rage bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
2:01.797 devastate Fluffy_Pillow 25.0/100: 25% rage bloodbath, blood_craze, unyielding_strikes, spirit_of_the_warlords
2:03.160 shield_charge Fluffy_Pillow 25.0/100: 25% rage bloodbath, unyielding_strikes(2), spirit_of_the_warlords
2:03.160 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodbath, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:03.160 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodbath, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:04.525 dragon_roar Fluffy_Pillow 5.0/100: 5% rage bloodbath, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:05.891 devastate Fluffy_Pillow 5.0/100: 5% rage bloodbath, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:05.891 heroic_strike Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
2:07.254 devastate Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
2:08.620 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4), spirit_of_the_warlords
2:08.620 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:09.984 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:09.984 revenge Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:11.348 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords
2:11.348 devastate Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords
2:12.714 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords
2:12.714 shield_slam Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords
2:14.079 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
2:14.079 devastate Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
2:15.444 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:15.444 devastate Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:16.807 berserker_rage Fluffy_Pillow 50.0/100: 50% rage unyielding_strikes(6)
2:16.807 heroic_strike Fluffy_Pillow 60.0/100: 60% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:16.807 devastate Fluffy_Pillow 60.0/100: 60% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:16.807 shield_charge Fluffy_Pillow 40.0/100: 40% rage berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
2:18.171 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
2:18.171 shield_slam Fluffy_Pillow 40.0/100: 40% rage berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
2:19.536 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, enrage, enraged_speed, shield_charge
2:19.536 revenge Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, shield_charge
2:20.902 heroic_strike Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, shield_charge
2:20.902 devastate Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge
2:22.265 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
2:22.265 shield_slam Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
2:23.628 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes
2:23.628 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes
2:24.993 heroic_leap Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(2)
2:24.993 devastate Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(2)
2:26.359 devastate Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(3)
2:27.724 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, unyielding_strikes(4)
2:27.724 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4)
2:29.088 revenge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4)
2:29.088 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(4)
2:30.452 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(4)
2:30.452 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4)
2:31.816 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(5)
2:31.816 devastate Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, unyielding_strikes(5)
2:33.180 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, unyielding_strikes(6)
2:33.180 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, unyielding_strikes(6)
2:34.544 heroic_strike Fluffy_Pillow 35.0/100: 35% rage unyielding_strikes(6)
2:34.544 devastate Fluffy_Pillow 35.0/100: 35% rage unyielding_strikes(6)
2:35.908 heroic_strike Fluffy_Pillow 35.0/100: 35% rage unyielding_strikes(6)
2:35.908 devastate Fluffy_Pillow 35.0/100: 35% rage unyielding_strikes(6)
2:37.275 devastate Fluffy_Pillow 35.0/100: 35% rage
2:37.275 shield_charge Fluffy_Pillow 15.0/100: 15% rage shield_charge, sword_and_board, unyielding_strikes
2:38.639 shield_slam Fluffy_Pillow 15.0/100: 15% rage shield_charge, sword_and_board, unyielding_strikes
2:38.639 heroic_strike Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes
2:40.002 revenge Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes
2:40.002 heroic_strike Fluffy_Pillow 10.0/100: 10% rage shield_charge, unyielding_strikes
2:41.367 devastate Fluffy_Pillow 10.0/100: 10% rage shield_charge, unyielding_strikes
2:42.731 devastate Fluffy_Pillow 10.0/100: 10% rage shield_charge, unyielding_strikes(2)
2:44.095 shield_slam Fluffy_Pillow 10.0/100: 10% rage shield_charge, sword_and_board, unyielding_strikes(3)
2:44.095 heroic_strike Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes(3)
2:45.458 devastate Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(3)
2:46.823 berserker_rage Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(4)
2:46.823 heroic_strike Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
2:46.823 devastate Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
2:48.189 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
2:48.189 devastate Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
2:49.553 heroic_strike Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:49.553 shield_slam Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:50.917 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:50.917 revenge Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:52.281 heroic_strike Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:52.281 devastate Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:53.645 devastate Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed
2:53.645 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes
2:55.011 shield_charge Fluffy_Pillow 30.0/100: 30% rage unyielding_strikes
2:55.011 shield_slam Fluffy_Pillow 10.0/100: 10% rage shield_charge, unyielding_strikes
2:55.011 heroic_strike Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes
2:56.375 devastate Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes
2:57.740 devastate Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(2)
2:59.104 devastate Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(3)
3:00.469 bloodbath Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(4)
3:00.469 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodbath, shield_charge, unyielding_strikes(4)
3:00.469 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, shield_charge, unyielding_strikes(4)
3:01.830 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, shield_charge, unyielding_strikes(4)
3:01.830 revenge Fluffy_Pillow 5.0/100: 5% rage bloodbath, shield_charge, unyielding_strikes(4)
3:03.195 devastate Fluffy_Pillow 25.0/100: 25% rage bloodbath, unyielding_strikes(4)
3:03.195 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, unyielding_strikes(5)
3:04.558 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, unyielding_strikes(5)
3:04.558 dragon_roar Fluffy_Pillow 15.0/100: 15% rage bloodbath, unyielding_strikes(5)
3:05.923 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, unyielding_strikes(5)
3:05.923 shield_slam Fluffy_Pillow 10.0/100: 10% rage bloodbath, unyielding_strikes(5)
3:07.288 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodbath, unyielding_strikes(5)
3:07.288 devastate Fluffy_Pillow 25.0/100: 25% rage bloodbath, unyielding_strikes(5)
3:08.651 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6)
3:08.651 devastate Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6)
3:10.015 heroic_leap Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6)
3:10.015 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6)
3:10.015 devastate Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6)
3:11.379 shield_charge Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6)
3:11.379 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:11.379 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:12.744 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, ultimatum
3:12.744 revenge Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge
3:14.110 heroic_strike Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, shield_charge
3:14.110 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge
3:15.475 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes
3:15.475 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes
3:16.840 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
3:16.840 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:18.205 devastate Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:18.205 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
3:19.570 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(3)
3:19.570 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(3)
3:20.935 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(3)
3:20.935 shield_charge Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
3:22.299 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
3:22.299 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
3:23.664 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
3:23.664 revenge Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
3:25.026 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
3:25.026 devastate Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
3:26.390 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
3:26.390 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
3:27.754 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:27.754 shield_slam Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:29.118 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes(6)
3:29.118 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes(6)
3:30.118 shield_charge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
3:30.481 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
3:30.481 shield_slam Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
3:31.846 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge
3:31.846 devastate Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge
3:33.212 berserker_rage Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes
3:33.212 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
3:33.212 revenge Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
3:34.577 devastate Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
3:34.577 heroic_strike Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:35.942 shield_slam Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:35.942 heroic_strike Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:37.306 devastate Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
3:38.670 devastate Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
3:40.035 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, unyielding_strikes(4)
3:40.035 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, unyielding_strikes(5)
3:41.397 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, unyielding_strikes(5)
3:41.397 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, unyielding_strikes(5)
3:42.761 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(5)
3:42.761 revenge Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, unyielding_strikes(5)
3:44.125 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(5)
3:44.125 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(5)
3:45.490 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6)
3:45.490 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6)
3:46.856 shield_charge Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6)
3:46.856 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:46.856 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:48.221 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), ultimatum
3:48.221 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:49.586 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, sword_and_board
3:49.586 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board
3:50.950 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge
3:50.950 devastate Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge
3:52.315 revenge Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes
3:52.315 heroic_strike Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
3:53.682 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
3:55.047 heroic_leap Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(2), spirit_of_the_warlords
3:55.047 shield_slam Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(2), spirit_of_the_warlords
3:55.047 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(2), spirit_of_the_warlords
3:56.411 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(2), spirit_of_the_warlords
3:57.774 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords
3:59.140 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords
3:59.140 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
4:00.505 bloodbath Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
4:00.505 shield_charge Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
4:00.505 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:00.505 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:01.867 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:01.867 revenge Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:03.233 berserker_rage Fluffy_Pillow 35.0/100: 35% rage bloodbath, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:03.233 heroic_strike Fluffy_Pillow 45.0/100: 45% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:03.233 devastate Fluffy_Pillow 40.0/100: 40% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:04.599 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
4:04.599 shield_slam Fluffy_Pillow 40.0/100: 40% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
4:05.964 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
4:05.964 dragon_roar Fluffy_Pillow 65.0/100: 65% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
4:07.329 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
4:07.329 execute Fluffy_Pillow 65.0/100: 65% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
4:08.694 devastate Fluffy_Pillow 35.0/100: 35% rage berserker_rage, bloodbath, enrage, enraged_speed, spirit_of_the_warlords
4:10.057 shield_slam Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:10.057 heroic_strike Fluffy_Pillow 65.0/100: 65% rage bloodbath, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:11.420 revenge Fluffy_Pillow 65.0/100: 65% rage bloodbath, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:11.420 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:12.784 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes
4:14.149 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(2)
4:15.516 shield_charge Fluffy_Pillow 60.0/100: 60% rage blood_craze, enrage, enraged_speed, unyielding_strikes(3)
4:15.516 shield_slam Fluffy_Pillow 40.0/100: 40% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
4:16.880 devastate Fluffy_Pillow 60.0/100: 60% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
4:18.245 devastate Fluffy_Pillow 60.0/100: 60% rage shield_charge, unyielding_strikes(4)
4:18.245 heroic_strike Fluffy_Pillow 55.0/100: 55% rage shield_charge, unyielding_strikes(5)
4:19.609 heroic_strike Fluffy_Pillow 55.0/100: 55% rage shield_charge, unyielding_strikes(5)
4:19.609 devastate Fluffy_Pillow 50.0/100: 50% rage shield_charge, unyielding_strikes(5)
4:20.972 heroic_strike Fluffy_Pillow 50.0/100: 50% rage shield_charge, sword_and_board, unyielding_strikes(6)
4:20.972 shield_slam Fluffy_Pillow 50.0/100: 50% rage shield_charge, sword_and_board, unyielding_strikes(6)
4:22.335 heroic_strike Fluffy_Pillow 75.0/100: 75% rage shield_charge, unyielding_strikes(6)
4:22.335 revenge Fluffy_Pillow 75.0/100: 75% rage shield_charge, unyielding_strikes(6)
4:23.700 heroic_strike Fluffy_Pillow 95.0/100: 95% rage unyielding_strikes(6)
4:23.700 execute Fluffy_Pillow 95.0/100: 95% rage unyielding_strikes(6)
4:25.063 execute Fluffy_Pillow 65.0/100: 65% rage
4:26.428 shield_slam Fluffy_Pillow 35.0/100: 35% rage
4:27.794 devastate Fluffy_Pillow 55.0/100: 55% rage
4:29.157 devastate Fluffy_Pillow 55.0/100: 55% rage unyielding_strikes
4:30.522 execute Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, unyielding_strikes(2)
4:31.887 shield_charge Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2)
4:31.887 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:33.252 devastate Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:34.617 revenge Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
4:35.982 devastate Fluffy_Pillow 55.0/100: 55% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
4:37.345 shield_slam Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:37.345 heroic_strike Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:38.710 execute Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:40.074 heroic_leap Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(4)
4:40.074 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(4)
4:40.074 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
4:41.438 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
4:41.438 shield_slam Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
4:42.803 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(5)
4:42.803 devastate Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(5)
4:44.168 berserker_rage Fluffy_Pillow 55.0/100: 55% rage unyielding_strikes(6)
4:44.168 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
4:44.168 revenge Fluffy_Pillow 65.0/100: 65% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
4:45.530 heroic_strike Fluffy_Pillow 85.0/100: 85% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
4:45.530 execute Fluffy_Pillow 85.0/100: 85% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
4:46.894 shield_charge Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
4:46.894 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:46.894 shield_slam Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:48.257 heroic_strike Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, shield_charge
4:48.257 devastate Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge
4:49.621 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
4:49.621 devastate Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
4:50.985 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:52.351 shield_slam Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(3)
4:52.351 heroic_strike Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(3)
4:53.716 revenge Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(3)
4:53.716 heroic_strike Fluffy_Pillow 10.0/100: 10% rage shield_charge, unyielding_strikes(3)
4:55.081 devastate Fluffy_Pillow 10.0/100: 10% rage unyielding_strikes(3)
4:55.081 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, unyielding_strikes(4)
4:56.444 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, unyielding_strikes(4)
4:56.444 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, unyielding_strikes(4)
4:57.808 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, unyielding_strikes(5)
4:57.808 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, unyielding_strikes(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4129 3683 3683 (1596)
Agility 933 889 889
Stamina 4312 3920 3778
Intellect 746 711 711
Spirit 679 679 679
Health 258720 235200 0
Rage 100 100 0
Crit 19.49% 13.58% 944
Haste 10.23% 4.98% 498
Multistrike 6.68% 1.68% 111
Damage / Heal Versatility 7.83% 4.83% 628
Attack Power 5508 4351 0
Mastery 30.10% 22.24% 751
Armor 2781 2781 2675
Bonus Armor 106 106 106

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Heavy Repercussions (Protection Warrior) Sudden Death Unyielding Strikes (Protection Warrior)
60 Storm Bolt Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Bladestorm
100 Anger Management Ravager Gladiator's Resolve (Protection Warrior)

Profile

warrior="Dârkride"
origin="http://eu.battle.net/wow/en/character/forscherliga/Dârkride/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/237/36647661-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=blacksmithing=666/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Zb!1022212
glyphs=enraged_speed/cleave/bull_rush/gushing_wound/bloodcurdling_shout/mystic_shout
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=blackrock_barbecue
#
talent_override=bladestorm,if=raid_event.adds.count>1|desired_targets>2|(raid_event.adds.duration<10&raid_event.adds.exists)
talent_override=dragon_roar,if=raid_event.adds.count>=1|desired_targets>1
actions.precombat+=/stance,choose=gladiator
# Snapshot raid buffed stats before combat begins and pre-potting is done.
# Generic on-use trinket line if needed when swapping trinkets out.
#actions+=/use_item,slot=trinket1,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_armor

# Executed every time the actor is available.

actions=charge
actions+=/auto_attack
# This is mostly to prevent cooldowns from being accidentally used during movement.
actions+=/call_action_list,name=movement,if=movement.distance>5
actions+=/avatar
actions+=/bloodbath
actions+=/blood_fury,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions+=/berserking,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions+=/arcane_torrent,if=rage<rage.max-40
actions+=/potion,name=draenic_armor,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up
actions+=/shield_charge,if=(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
actions+=/berserker_rage,if=buff.enrage.down
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
actions+=/heroic_strike,if=(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
actions+=/heroic_strike,if=buff.ultimatum.up|rage>=rage.max-20|buff.unyielding_strikes.stack>4|target.time_to_die<10
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>=2

actions.movement=heroic_leap
actions.movement+=/shield_charge
# May as well throw storm bolt if we can.
actions.movement+=/storm_bolt
actions.movement+=/heroic_throw

actions.single=devastate,if=buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
actions.single+=/shield_slam
actions.single+=/revenge
actions.single+=/execute,if=buff.sudden_death.react
actions.single+=/storm_bolt
actions.single+=/dragon_roar
actions.single+=/execute,if=rage>60&target.health.pct<20
actions.single+=/devastate

actions.aoe=revenge
actions.aoe+=/shield_slam
actions.aoe+=/dragon_roar,if=(buff.bloodbath.up|cooldown.bloodbath.remains>10)|!talent.bloodbath.enabled
actions.aoe+=/storm_bolt,if=(buff.bloodbath.up|cooldown.bloodbath.remains>7)|!talent.bloodbath.enabled
actions.aoe+=/thunder_clap,cycle_targets=1,if=dot.deep_wounds.remains<3&active_enemies>4
actions.aoe+=/bladestorm,if=buff.shield_charge.down
actions.aoe+=/execute,if=buff.sudden_death.react
actions.aoe+=/thunder_clap,if=active_enemies>6
actions.aoe+=/devastate,cycle_targets=1,if=dot.deep_wounds.remains<5&cooldown.shield_slam.remains>execute_time*0.4
actions.aoe+=/devastate,if=cooldown.shield_slam.remains>execute_time*0.4

head=casque_of_the_iron_bomber,id=113600
neck=flesh_beetle_brooch,id=109968,bonus_id=524,enchant=40crit
shoulders=verdant_plate_spaulders,id=109944,bonus_id=524
back=milenahs_intricate_cloak,id=119345,enchant=100crit
chest=gutcrusher_chestplate,id=109895,bonus_id=499/523/524,gems=35crit
shirt=antisepticsoaked_dressing,id=44694
wrists=verdant_plate_wristguards,id=109877,bonus_id=523/524,gems=35crit
hands=gauntlets_of_the_heavy_hand,id=113632,bonus_id=563,gems=35crit
waist=ripswallow_plate_belt,id=119337,bonus_id=560
legs=truesteel_greaves,id=114234,bonus_id=94/525/533
feet=entrail_squishers,id=113633
finger1=timeless_solium_band_of_the_bulwark,id=118298
finger2=knucklebone_of_lodronar,id=109772,bonus_id=524,enchant=30mastery
trinket1=mote_of_corruption,id=110010,bonus_id=524
trinket2=skull_of_war,id=112318,bonus_id=525/529
main_hand=tharbeks_brutal_posessor,id=118726,bonus_id=524,enchant=mark_of_the_shattered_hand
off_hand=ogre_dinner_plate,id=110044,bonus_id=524

# Gear Summary
# gear_strength=2228
# gear_stamina=2844
# gear_crit_rating=944
# gear_haste_rating=498
# gear_mastery_rating=715
# gear_armor=2675
# gear_bonus_armor=106
# gear_multistrike_rating=111
# gear_versatility_rating=528

Simulation & Raid Information

Iterations: 25004
Threads: 4
Confidence: 95.00%
Fight Length: 229 - 375 ( 300.9 )

Performance:

Total Events Processed: 1046692488
Max Event Queue: 381
Sim Seconds: 7523779
CPU Seconds: 420.8230
Physical Seconds: 420.8230
Speed Up: 17879

Settings:

World Lag: 50 ms ( stddev = 5 ms )
Queue Lag: 5 ms ( stddev = 1 ms )
Simulation Length
Sample Data Simulation Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
Standard Deviation 39.3904
5th Percentile 241.86
95th Percentile 362.99
( 95th Percentile - 5th Percentile ) 121.13
Mean Distribution
Standard Deviation 0.2491
95.00% Confidence Intervall ( 300.41 - 301.39 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 658
0.1% Error 65830
0.1 Scale Factor Error with Delta=300 13
0.05 Scale Factor Error with Delta=300 52
0.01 Scale Factor Error with Delta=300 1324
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Ciaran Ciaran celestial_alignment 112071 0 0 0.40 0 0 2.0 2.0 16.4% 0.0% 0.0% 0.0% 181.85sec 0 300.90sec
Ciaran Ciaran draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Ciaran Ciaran force_of_nature 33831 0 0 3.37 0 0 16.9 16.9 15.7% 0.0% 0.0% 0.0% 19.57sec 0 300.90sec
Ciaran Ciaran moonfire 8921 51287 170 1.80 4686 9014 9.0 9.0 16.0% 0.0% 0.0% 0.0% 34.97sec 749665 300.90sec
Ciaran Ciaran moonfire ticks -8921 698378 2328 34.99 3236 6544 9.0 174.9 16.1% 0.0% 0.0% 0.0% 34.97sec 749665 300.90sec
Ciaran Ciaran moonkin_form 24858 0 0 0.20 0 0 1.0 1.0 13.7% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Ciaran Ciaran shattered_bleed 159238 34636 115 3.46 1622 3257 17.4 17.4 16.0% 0.0% 0.0% 0.0% 17.68sec 115470 300.90sec
Ciaran Ciaran shattered_bleed ticks -159238 80834 269 19.41 786 0 17.4 97.1 0.0% 0.0% 0.0% 0.0% 17.68sec 115470 300.90sec
Ciaran Ciaran starfire 2912 2011031 6683 10.50 30824 62947 52.6 52.6 16.4% 0.0% 0.0% 0.0% 5.61sec 2011031 300.90sec
Ciaran Ciaran starsurge 78674 1187228 3946 6.17 30989 63208 31.1 30.9 16.4% 0.0% 0.0% 0.0% 9.86sec 1187228 300.90sec
Ciaran Ciaran sunfire 93402 79759 265 1.90 6808 13742 9.5 9.5 15.7% 0.0% 0.0% 0.0% 32.33sec 696049 300.90sec
Ciaran Ciaran sunfire ticks -93402 616290 2054 33.66 2967 6015 9.5 168.3 16.1% 0.0% 0.0% 0.0% 32.33sec 696049 300.90sec
Ciaran Ciaran wrath 5176 1201659 3994 11.98 16338 32714 60.4 60.1 15.5% 0.0% 0.0% 0.0% 4.35sec 1201659 300.90sec
Ciaran Ciaran_treant wrath 113769 45583 209 28.26 361 726 102.9 102.5 16.1% 0.0% 0.0% 0.0% 3.10sec 45583 217.63sec
Kernoris Kernoris berserk 106952 0 0 0.40 0 0 2.0 2.0 28.8% 0.0% 0.0% 0.0% 183.31sec 0 300.90sec
Kernoris Kernoris cat_form 768 0 0 0.20 0 0 1.0 1.0 29.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Kernoris Kernoris cat_melee 0 1543683 5130 70.84 3221 6444 355.3 355.3 28.9% 0.0% 0.0% 0.0% 0.85sec 2372397 300.90sec
Kernoris Kernoris draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Kernoris Kernoris ferocious_bite 22568 1056952 3513 2.81 45477 90927 14.1 14.1 57.8% 0.0% 0.0% 0.0% 21.57sec 1624369 300.90sec
Kernoris Kernoris healing_touch 5185 0 0 5.81 0 0 29.1 29.1 31.9% 0.0% 0.0% 0.0% 10.54sec 951994 300.90sec
Kernoris Kernoris leader_of_the_pack 68285 0 0 7.96 0 0 39.9 39.9 0.0% 0.0% 0.0% 0.0% 7.62sec 328767 300.90sec
Kernoris Kernoris rake 1822 197491 656 4.63 6306 12606 23.2 23.2 28.9% 0.0% 0.0% 0.0% 13.05sec 1055966 300.90sec
Kernoris Kernoris rake ticks -1822 858475 2862 19.79 6422 12855 23.2 99.0 28.9% 0.0% 0.0% 0.0% 13.05sec 1055966 300.90sec
Kernoris Kernoris rip ticks -1079 1253045 4177 28.61 6496 12993 9.4 143.1 28.8% 0.0% 0.0% 0.0% 24.97sec 1253045 300.90sec
Kernoris Kernoris savage_roar 52610 0 0 1.53 0 0 7.7 7.7 0.0% 0.0% 0.0% 0.0% 37.65sec 0 300.90sec
Kernoris Kernoris shattered_bleed 159238 54303 180 3.48 2303 4608 17.5 17.5 28.9% 0.0% 0.0% 0.0% 17.53sec 171053 300.90sec
Kernoris Kernoris shattered_bleed ticks -159238 116751 389 19.64 1135 0 17.5 98.2 0.0% 0.0% 0.0% 0.0% 17.53sec 171053 300.90sec
Kernoris Kernoris shred 5221 1230428 4089 19.66 9252 18496 98.6 98.6 28.9% 0.0% 0.0% 0.0% 3.05sec 1890974 300.90sec
Kernoris Kernoris thrash_cat 106830 15244 51 0.49 4593 9184 2.5 2.5 28.7% 0.0% 0.0% 0.0% 61.73sec 68926 300.90sec
Kernoris Kernoris thrash_cat ticks -106830 53682 179 2.43 3283 6563 2.5 12.1 28.7% 0.0% 0.0% 0.0% 61.73sec 68926 300.90sec
Kernoris Kernoris tigers_fury 5217 0 0 2.04 0 0 10.2 10.2 28.9% 0.0% 0.0% 0.0% 30.54sec 0 300.90sec
Rapáx Rapáx a_murder_of_crows 131894 0 0 1.04 0 0 5.2 5.2 0.0% 0.0% 0.0% 0.0% 63.19sec 0 300.90sec
Rapáx Rapáx crow_peck 131900 459372 1527 15.22 4021 8231 0.0 76.3 38.7% 0.0% 0.0% 0.0% 0.00sec 705982 300.90sec
Rapáx Rapáx arcane_shot 3044 966772 3213 17.45 7514 15170 87.9 87.5 35.8% 0.0% 0.0% 0.0% 3.40sec 966772 300.90sec
Rapáx Rapáx auto_shot 0 562386 1869 21.27 3582 7239 106.7 106.7 35.8% 0.0% 0.0% 0.0% 2.83sec 864298 300.90sec
Rapáx Rapáx barrage ticks -120360 633347 2111 35.36 2343 4746 11.1 176.8 35.9% 0.0% 0.0% 0.0% 27.18sec 936925 300.90sec
Rapáx Rapáx black_arrow ticks -3674 732508 2442 23.50 4231 8575 12.2 117.5 35.7% 0.0% 0.0% 0.0% 25.74sec 732508 300.90sec
Rapáx Rapáx draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Rapáx Rapáx explosive_shot 53301 344516 1145 14.70 3174 6428 74.0 73.7 35.7% 0.0% 0.0% 0.0% 4.07sec 1369769 300.90sec
Rapáx Rapáx explosive_shot ticks -53301 1025252 3418 33.82 4118 8327 74.0 169.1 35.8% 0.0% 0.0% 0.0% 4.07sec 1369769 300.90sec
Rapáx Rapáx focusing_shot 152245 363895 1209 8.49 5825 11756 42.6 42.6 35.5% 0.0% 0.0% 0.0% 6.96sec 559250 300.90sec
Rapáx Rapáx serpent_sting ticks -118253 1132375 3775 37.17 4146 8385 87.5 185.8 35.6% 0.0% 0.0% 0.0% 3.40sec 1132375 300.90sec
Rapáx Rapáx summon_pet 0 0 0 0.20 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Rapáx Rapáx_cat claw 16827 213606 710 14.55 1859 3792 73.0 73.0 46.0% 0.0% 0.0% 0.0% 4.17sec 328279 300.90sec
Rapáx Rapáx_cat melee 0 517779 1721 39.18 1683 3409 196.5 196.5 45.9% 0.0% 0.0% 0.0% 1.53sec 795745 300.90sec
Rosalîîe Rosalîîe a_murder_of_crows 131894 0 0 1.05 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 62.18sec 0 300.90sec
Rosalîîe Rosalîîe crow_peck 131900 467900 1555 15.44 4299 8599 0.0 77.4 27.7% 0.0% 0.0% 0.0% 0.00sec 719088 300.90sec
Rosalîîe Rosalîîe arcane_shot 3044 618959 2057 8.35 10355 20705 42.2 41.9 27.8% 0.0% 0.0% 0.0% 7.16sec 618959 300.90sec
Rosalîîe Rosalîîe auto_shot 0 721019 2396 21.60 4670 9337 108.3 108.3 27.7% 0.0% 0.0% 0.0% 2.79sec 1108092 300.90sec
Rosalîîe Rosalîîe barrage ticks -120360 663788 2213 36.90 2406 4812 11.5 184.5 27.7% 0.0% 0.0% 0.0% 25.64sec 967476 300.90sec
Rosalîîe Rosalîîe black_arrow ticks -3674 1030112 3434 23.99 6026 12052 12.4 119.9 27.7% 0.0% 0.0% 0.0% 25.17sec 1030112 300.90sec
Rosalîîe Rosalîîe cobra_shot 77767 689151 2290 15.57 6201 12403 78.3 78.1 27.6% 0.0% 0.0% 0.0% 3.77sec 689151 300.90sec
Rosalîîe Rosalîîe draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Rosalîîe Rosalîîe explosive_shot 53301 475817 1581 14.69 4530 9059 73.9 73.7 27.7% 0.0% 0.0% 0.0% 4.07sec 1889391 300.90sec
Rosalîîe Rosalîîe explosive_shot ticks -53301 1413574 4712 33.31 5958 11914 73.9 166.5 27.7% 0.0% 0.0% 0.0% 4.07sec 1889391 300.90sec
Rosalîîe Rosalîîe serpent_sting ticks -118253 894709 2982 27.94 4493 8985 41.9 139.7 27.7% 0.0% 0.0% 0.0% 7.18sec 894709 300.90sec
Procrank Procrank draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Procrank Procrank frostbolt 116 1316244 4374 20.62 9081 18312 103.7 103.4 13.5% 0.0% 0.0% 0.0% 2.87sec 1316244 300.90sec
Procrank Procrank icicle_fb 148022 544826 1811 35.52 3058 0 179.2 178.1 0.0% 0.0% 0.0% 0.0% 1.98sec 544826 300.90sec
Procrank Procrank frostfire_bolt 44614 991535 3295 5.90 15328 30964 29.7 29.6 70.9% 0.0% 0.0% 0.0% 9.85sec 991535 300.90sec
Procrank Procrank icicle_ffb 148022 379603 1262 10.83 6989 0 54.6 54.3 0.0% 0.0% 0.0% 0.0% 5.59sec 379603 300.90sec
Procrank Procrank frozen_orb 84714 0 0 1.08 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 61.14sec 0 300.90sec
Procrank Procrank frozen_orb_bolt 84721 245813 817 10.60 3086 6159 0.0 53.2 16.5% 0.0% 0.0% 0.0% 0.00sec 245813 300.90sec
Procrank Procrank ice_lance 30455 1322656 4396 9.78 12429 25006 49.2 49.0 71.9% 0.0% 0.0% 0.0% 6.08sec 1322656 300.90sec
Procrank Procrank ice_nova 157997 624002 2074 2.68 31662 63530 13.4 13.4 14.2% 0.0% 0.0% 0.0% 23.09sec 624002 300.90sec
Procrank Procrank icy_veins 12472 0 0 0.41 0 0 2.1 2.1 12.6% 0.0% 0.0% 0.0% 181.34sec 0 300.90sec
Procrank Procrank mirror_image 55342 0 0 0.60 0 0 3.0 3.0 13.9% 0.0% 0.0% 0.0% 121.01sec 0 300.90sec
Procrank Procrank_mirror_image frostbolt 59638 1032208 9245 107.91 3413 6927 201.8 200.8 17.7% 0.0% 0.0% 0.0% 4.06sec 1032208 111.65sec
Procrank Procrank shattered_bleed 159238 37982 126 3.39 1591 3182 17.0 17.0 13.8% 0.0% 0.0% 0.0% 18.00sec 132476 300.90sec
Procrank Procrank shattered_bleed ticks -159238 94494 315 19.24 788 0 17.0 96.2 0.0% 0.0% 0.0% 0.0% 18.00sec 132476 300.90sec
Procrank Procrank water_elemental 31687 0 0 0.20 0 0 1.0 1.0 11.3% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Procrank Procrank_water_elemental water_jet ticks -135029 127917 426 7.93 2264 4572 10.0 39.7 14.7% 0.0% 0.0% 0.0% 30.39sec 127917 300.90sec
Procrank Procrank_water_elemental waterbolt 31707 620013 2061 22.59 3851 7763 114.2 113.3 13.8% 0.0% 0.0% 0.0% 2.62sec 620013 300.90sec
Zentimeter Zentimeter draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Zentimeter Zentimeter frostbolt 116 1152175 3829 20.68 8192 16387 104.0 103.7 8.4% 0.0% 0.0% 0.0% 2.86sec 1152175 300.90sec
Zentimeter Zentimeter icicle_fb 148022 551126 1832 36.94 2975 0 186.4 185.3 0.0% 0.0% 0.0% 0.0% 1.94sec 551126 300.90sec
Zentimeter Zentimeter frostfire_bolt 44614 911953 3031 6.25 13920 27837 31.4 31.3 62.8% 0.0% 0.0% 0.0% 9.33sec 911953 300.90sec
Zentimeter Zentimeter icicle_ffb 148022 399033 1326 11.84 6718 0 59.7 59.4 0.0% 0.0% 0.0% 0.0% 5.17sec 399033 300.90sec
Zentimeter Zentimeter frozen_orb 84714 0 0 1.08 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 60.95sec 0 300.90sec
Zentimeter Zentimeter frozen_orb_bolt 84721 210748 700 10.62 2792 5582 0.0 53.3 8.4% 0.0% 0.0% 0.0% 0.00sec 210748 300.90sec
Zentimeter Zentimeter ice_lance 30455 1156680 3844 9.87 11270 22539 49.7 49.5 62.5% 0.0% 0.0% 0.0% 6.03sec 1156680 300.90sec
Zentimeter Zentimeter ice_nova 157997 543720 1807 2.68 28634 57271 13.4 13.4 8.4% 0.0% 0.0% 0.0% 23.09sec 543720 300.90sec
Zentimeter Zentimeter icy_veins 12472 0 0 0.41 0 0 2.1 2.1 8.1% 0.0% 0.0% 0.0% 181.15sec 0 300.90sec
Zentimeter Zentimeter mirror_image 55342 0 0 0.60 0 0 3.0 3.0 8.2% 0.0% 0.0% 0.0% 120.98sec 0 300.90sec
Zentimeter Zentimeter_mirror_image frostbolt 59638 870586 7797 107.97 3088 6176 201.9 200.9 8.4% 0.0% 0.0% 0.0% 4.06sec 870586 111.65sec
Zentimeter Zentimeter shattered_bleed 159238 36631 122 3.43 1571 3143 17.2 17.2 8.4% 0.0% 0.0% 0.0% 17.86sec 132304 300.90sec
Zentimeter Zentimeter shattered_bleed ticks -159238 95674 319 19.43 778 0 17.2 97.2 0.0% 0.0% 0.0% 0.0% 17.86sec 132304 300.90sec
Zentimeter Zentimeter water_elemental 31687 0 0 0.20 0 0 1.0 1.0 8.4% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Zentimeter Zentimeter_water_elemental water_jet ticks -135029 115457 385 7.95 2133 4269 10.0 39.7 8.4% 0.0% 0.0% 0.0% 30.31sec 115457 300.90sec
Zentimeter Zentimeter_water_elemental waterbolt 31707 572221 1902 22.93 3627 7253 116.0 115.0 8.4% 0.0% 0.0% 0.0% 2.58sec 572221 300.90sec
Zambo Zambo avenging_wrath 31884 0 0 0.59 0 0 2.9 2.9 17.0% 0.0% 0.0% 0.0% 121.96sec 0 300.90sec
Zambo Zambo censure ticks -31803 220904 736 19.87 1826 3664 295.9 99.4 13.6% 0.0% 0.0% 0.0% 1.01sec 220904 300.90sec
Zambo Zambo crusader_strike 35395 514406 1710 12.33 6840 13735 61.8 61.8 13.5% 0.0% 0.0% 0.0% 4.84sec 790561 300.90sec
Zambo Zambo divine_storm 53385 510807 1698 4.04 20732 41637 20.3 20.3 13.5% 0.0% 0.0% 0.0% 14.10sec 510807 300.90sec
Zambo Zambo draenic_strength_potion 156428 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Zambo Zambo execution_sentence ticks -114157 373920 1246 10.64 5708 11723 5.4 53.2 14.2% 0.0% 0.0% 0.0% 60.99sec 373920 300.90sec
Zambo Zambo exorcism 879 104352 347 1.82 9405 18815 9.1 9.1 13.5% 0.0% 0.0% 0.0% 18.19sec 104352 300.90sec
Zambo Zambo final_verdict 157048 1727621 5741 13.28 21323 42841 66.6 66.6 13.5% 0.0% 0.0% 0.0% 4.48sec 1727621 300.90sec
Zambo Zambo glyph_of_divine_storm 63220 0 0 4.04 0 0 20.3 20.3 16.8% 0.0% 0.0% 0.0% 14.10sec 273280 300.90sec
Zambo Zambo hammer_of_wrath 24275 599303 1992 6.03 16240 32835 30.2 30.2 13.7% 0.0% 0.0% 0.0% 10.16sec 599303 300.90sec
Zambo Zambo hand_of_light 96172 1927052 6404 44.09 8715 0 221.1 221.1 0.0% 0.0% 0.0% 0.0% 1.68sec 1927052 300.90sec
Zambo Zambo judgment 20271 451263 1500 7.80 9471 19092 39.1 39.1 13.5% 0.0% 0.0% 0.0% 7.63sec 451263 300.90sec
Zambo Zambo melee 0 739662 2458 19.57 6182 12443 98.2 98.2 13.7% 0.0% 0.0% 0.0% 3.05sec 1136744 300.90sec
Zambo Zambo seal_of_truth_proc 31801 413947 1376 59.01 1146 2305 295.9 295.9 13.9% 0.0% 0.0% 0.0% 1.01sec 413947 300.90sec
Zambo Zambo shattered_bleed 159238 35372 118 3.47 1665 3334 17.4 17.4 14.0% 0.0% 0.0% 0.0% 17.68sec 118122 300.90sec
Zambo Zambo shattered_bleed ticks -159238 82750 276 19.46 794 0 17.4 97.3 0.0% 0.0% 0.0% 0.0% 17.68sec 118122 300.90sec
Ðepeche Ðepeche avenging_wrath 31884 0 0 0.60 0 0 3.0 3.0 20.5% 0.0% 0.0% 0.0% 120.90sec 0 300.90sec
Ðepeche Ðepeche censure ticks -31803 210162 701 19.87 1690 3517 300.3 99.4 16.0% 0.0% 0.0% 0.0% 1.00sec 210162 300.90sec
Ðepeche Ðepeche crusader_strike 35395 482125 1602 12.24 6314 13055 61.4 61.4 15.5% 0.0% 0.0% 0.0% 4.89sec 740950 300.90sec
Ðepeche Ðepeche divine_storm 53385 382286 1270 3.18 19173 39826 15.9 15.9 16.1% 0.0% 0.0% 0.0% 17.71sec 382286 300.90sec
Ðepeche Ðepeche draenic_strength_potion 156428 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Ðepeche Ðepeche execution_sentence ticks -114157 359319 1198 10.74 5168 11401 5.5 53.7 17.8% 0.0% 0.0% 0.0% 60.48sec 359319 300.90sec
Ðepeche Ðepeche exorcism 879 105221 350 2.04 8487 16975 10.2 10.2 13.6% 0.0% 0.0% 0.0% 15.17sec 105221 300.90sec
Ðepeche Ðepeche final_verdict 157048 1300846 4323 10.45 19805 41159 52.4 52.4 16.2% 0.0% 0.0% 0.0% 5.71sec 1300846 300.90sec
Ðepeche Ðepeche hammer_of_wrath 24275 1079005 3586 10.57 15841 32908 53.0 53.0 18.9% 0.0% 0.0% 0.0% 5.71sec 1079005 300.90sec
Ðepeche Ðepeche hand_of_light 96172 1689852 5616 44.55 7563 0 223.4 223.4 0.0% 0.0% 0.0% 0.0% 1.64sec 1689852 300.90sec
Ðepeche Ðepeche judgment 20271 334220 1111 6.85 8011 16031 34.4 34.4 13.8% 0.0% 0.0% 0.0% 7.77sec 334220 300.90sec
Ðepeche Ðepeche melee 0 711787 2366 19.75 5739 11936 99.0 99.0 16.1% 0.0% 0.0% 0.0% 3.03sec 1093905 300.90sec
Ðepeche Ðepeche seal_of_truth_proc 31801 401918 1336 59.87 1066 2220 300.3 300.3 16.4% 0.0% 0.0% 0.0% 1.00sec 401918 300.90sec
Ðepeche Ðepeche shattered_bleed 159238 35820 119 3.51 1636 3338 17.6 17.6 16.1% 0.0% 0.0% 0.0% 17.40sec 116425 300.90sec
Ðepeche Ðepeche shattered_bleed ticks -159238 80605 269 19.63 769 0 17.6 98.2 0.0% 0.0% 0.0% 0.0% 17.40sec 116425 300.90sec
Swæty Swæty devouring_plague 2944 601545 1999 4.38 21604 43203 22.0 22.0 18.8% 0.0% 0.0% 0.0% 13.15sec 601545 300.90sec
Swæty Swæty devouring_plague_tick ticks -2944 591279 1971 26.80 3675 0 26.9 134.0 0.0% 0.0% 0.0% 0.0% 10.64sec 0 300.90sec
Swæty Swæty draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Swæty Swæty halo 120644 0 0 1.34 0 0 6.7 6.7 18.6% 0.0% 0.0% 0.0% 48.05sec 0 300.90sec
Swæty Swæty halo_damage 120696 203527 676 1.34 23992 47922 6.7 6.7 18.6% 0.0% 0.0% 0.0% 48.05sec 203527 300.90sec
Swæty Swæty insanity ticks -129197 918476 3062 19.04 7611 15223 35.4 95.2 18.7% 0.0% 0.0% 0.0% 7.85sec 918476 300.90sec
Swæty Swæty mind_blast 8092 1689093 5613 11.40 23311 46627 57.2 57.2 18.7% 0.0% 0.0% 0.0% 5.30sec 1689093 300.90sec
Swæty Swæty mind_spike 73510 1283326 4265 13.46 15001 30016 67.5 67.5 18.7% 0.0% 0.0% 0.0% 4.37sec 1283326 300.90sec
Swæty Swæty shadow_word_death 32379 411043 1366 2.31 27973 55957 11.6 11.6 18.7% 0.0% 0.0% 0.0% 5.36sec 411048 300.90sec
Swæty Swæty shadow_word_pain 589 33043 110 1.52 3414 6832 7.6 7.6 18.7% 0.0% 0.0% 0.0% 30.52sec 240192 300.90sec
Swæty Swæty shadow_word_pain ticks -589 207149 690 10.19 3202 6401 7.6 50.9 18.7% 0.0% 0.0% 0.0% 30.52sec 240192 300.90sec
Swæty Swæty shadowy_apparitions 78203 37871 126 1.90 3142 6285 9.5 9.5 18.7% 0.0% 0.0% 0.0% 22.36sec 37871 300.90sec
Swæty Swæty shadowfiend 34433 0 0 0.40 0 0 2.0 2.0 18.7% 0.0% 0.0% 0.0% 188.80sec 0 300.90sec
Swæty Swæty shadowform 15473 0 0 0.20 0 0 1.0 1.0 18.1% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Swæty Swæty shattered_bleed 159238 34138 113 3.41 1578 3156 17.1 17.1 18.6% 0.0% 0.0% 0.0% 18.00sec 114396 300.90sec
Swæty Swæty shattered_bleed ticks -159238 80258 268 19.26 780 0 17.1 96.3 0.0% 0.0% 0.0% 0.0% 18.00sec 114396 300.90sec
Swæty Swæty vampiric_touch ticks -34914 211525 705 8.64 3846 7695 7.5 43.2 18.7% 0.0% 0.0% 0.0% 31.24sec 211525 300.90sec
Swæty Swæty_shadowfiend melee 0 135756 5643 49.94 5349 10707 20.0 20.0 18.7% 0.0% 0.0% 0.0% 10.60sec 135756 24.06sec
Swæty Swæty_shadowfiend shadowcrawl 63619 0 0 15.00 0 0 6.0 6.0 18.7% 0.0% 0.0% 0.0% 40.51sec 0 24.06sec
Ralana Ralana adrenaline_rush 13750 0 0 0.77 0 0 3.9 3.9 0.0% 0.0% 0.0% 0.0% 86.90sec 0 300.90sec
Ralana Ralana ambush 8676 126783 421 1.42 14111 28202 7.1 7.1 19.8% 0.0% 0.0% 0.0% 48.55sec 194846 300.90sec
Ralana Ralana auto_attack_mh 0 1270253 4221 42.35 4737 9475 212.4 212.4 19.9% 0.0% 0.0% 0.0% 1.42sec 1952179 300.90sec
Ralana Ralana auto_attack_oh 1 597112 1984 41.68 2263 4527 209.0 209.0 19.9% 0.0% 0.0% 0.0% 1.44sec 917667 300.90sec
Ralana Ralana draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Ralana Ralana eviscerate 2098 920675 3060 7.06 20593 41187 35.4 35.4 19.9% 0.0% 0.0% 0.0% 8.11sec 1414933 300.90sec
Ralana Ralana instant_poison 157607 569336 1892 40.93 2196 4394 205.3 205.3 19.9% 0.0% 0.0% 0.0% 1.49sec 569336 300.90sec
Ralana Ralana killing_spree 51690 0 0 1.14 0 0 5.7 5.7 0.0% 0.0% 0.0% 0.0% 57.50sec 0 300.90sec
Ralana Ralana killing_spree_mh ticks -57841 234523 782 0.00 4560 9122 39.7 0.0 19.8% 0.0% 0.0% 0.0% 7.05sec 350950 300.90sec
Ralana Ralana killing_spree_oh ticks -57842 112026 373 0.00 2177 4357 39.7 0.0 19.9% 0.0% 0.0% 0.0% 7.05sec 167636 300.90sec
Ralana Ralana main_gauche 86392 847577 2817 44.00 3042 6084 220.7 220.7 19.9% 0.0% 0.0% 0.0% 1.43sec 1302591 300.90sec
Ralana Ralana preparation 14185 0 0 0.25 0 0 1.2 1.2 0.0% 0.0% 0.0% 0.0% 312.51sec 0 300.90sec
Ralana Ralana revealing_strike 84617 86423 287 2.53 5389 10786 12.7 12.7 20.0% 0.0% 0.0% 0.0% 24.26sec 1096045 300.90sec
Ralana Ralana sinister_strike 1752 1144260 3803 25.67 7043 14086 128.7 128.7 19.9% 0.0% 0.0% 0.0% 2.30sec 1758547 300.90sec
Ralana Ralana slice_and_dice 5171 0 0 1.95 0 0 9.8 9.8 0.0% 0.0% 0.0% 0.0% 32.13sec 0 300.90sec
Ralana Ralana vanish 1856 0 0 1.22 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 48.55sec 0 300.90sec
Mîrai Mîrai ambush 8676 804256 2673 6.44 17050 35456 32.3 32.3 27.4% 0.0% 0.0% 0.0% 9.11sec 873554 300.90sec
Mîrai Mîrai auto_attack_mh 0 1376692 4575 63.62 3564 7519 319.0 319.0 25.3% 19.0% 0.0% 0.0% 0.94sec 1644604 300.90sec
Mîrai Mîrai auto_attack_oh 1 675377 2244 63.10 1763 3719 316.4 316.4 25.3% 19.0% 0.0% 0.0% 0.95sec 809237 300.90sec
Mîrai Mîrai backstab 53 813077 2702 16.59 6913 14491 83.2 83.2 24.4% 0.0% 0.0% 0.0% 3.44sec 1022446 300.90sec
Mîrai Mîrai deadly_poison_dot ticks -2818 252599 842 19.89 1798 3701 199.5 99.5 25.2% 0.0% 0.0% 0.0% 1.51sec 252599 300.90sec
Mîrai Mîrai deadly_poison_instant 113780 262166 871 39.58 933 1925 198.5 198.5 25.3% 0.0% 0.0% 0.0% 1.51sec 262166 300.90sec
Mîrai Mîrai draenic_agility_potion 156423 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Mîrai Mîrai eviscerate 2098 1257119 4178 6.94 25300 53122 34.8 34.8 25.5% 0.0% 0.0% 0.0% 8.51sec 1443178 300.90sec
Mîrai Mîrai garrote ticks -703 10116 34 1.80 746 1516 1.0 9.0 34.1% 0.0% 0.0% 0.0% 0.00sec 10116 300.90sec
Mîrai Mîrai premeditation 14183 0 0 1.70 0 0 8.5 8.5 0.0% 0.0% 0.0% 0.0% 38.54sec 0 300.90sec
Mîrai Mîrai preparation 14185 0 0 0.23 0 0 1.2 1.2 0.0% 0.0% 0.0% 0.0% 312.71sec 0 300.90sec
Mîrai Mîrai rupture ticks -1943 1156770 3856 38.05 4306 8862 16.5 190.3 25.1% 0.0% 0.0% 0.0% 18.54sec 1156770 300.90sec
Mîrai Mîrai shadow_dance 51713 0 0 1.06 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 61.89sec 0 300.90sec
Mîrai Mîrai shadow_reflection 152151 0 0 0.57 0 0 2.9 2.9 0.0% 0.0% 0.0% 0.0% 124.29sec 0 300.90sec
Mîrai Mîrai shattered_bleed 159238 78958 262 6.83 1635 3340 34.3 34.3 25.2% 0.0% 0.0% 0.0% 9.21sec 223310 300.90sec
Mîrai Mîrai shattered_bleed ticks -159238 144352 481 33.22 777 0 34.3 166.1 0.0% 0.0% 0.0% 0.0% 9.21sec 223310 300.90sec
Mîrai Mîrai slice_and_dice 5171 0 0 1.76 0 0 8.8 8.8 0.0% 0.0% 0.0% 0.0% 35.85sec 0 300.90sec
Mîrai Mîrai vanish 1856 0 0 0.84 0 0 4.2 4.2 0.0% 0.0% 0.0% 0.0% 71.90sec 0 300.90sec
Mîrai Mîrai_shadow_reflection ambush 8676 130778 2915 13.78 8539 17258 10.3 10.3 32.6% 0.0% 0.0% 0.0% 24.65sec 200986 44.87sec
Mîrai Mîrai_shadow_reflection backstab 53 483 11 0.11 3891 7781 0.1 0.1 31.7% 0.0% 0.0% 0.0% 64.39sec 742 44.87sec
Mîrai Mîrai_shadow_reflection eviscerate 2098 69742 1554 3.63 17381 35211 2.7 2.7 31.6% 0.0% 0.0% 0.0% 107.04sec 107183 44.87sec
Mîrai Mîrai_shadow_reflection rupture ticks -1943 99531 332 4.20 3338 6825 1.8 21.0 26.2% 0.0% 0.0% 0.0% 162.64sec 99531 44.87sec
Shaerlyn Shaerlyn ascendance 165339 0 0 0.40 0 0 2.0 2.0 15.1% 0.0% 0.0% 0.0% 181.25sec 0 300.90sec
Shaerlyn Shaerlyn draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Shaerlyn Shaerlyn earth_shock 8042 254907 847 3.20 9592 23967 16.1 16.1 15.0% 0.0% 0.0% 0.0% 18.36sec 254907 300.90sec
Shaerlyn Shaerlyn fulmination 88766 690751 2296 3.20 25926 64858 16.1 16.1 15.2% 0.0% 0.0% 0.0% 18.36sec 690751 300.90sec
Shaerlyn Shaerlyn elemental_mastery 16166 0 0 0.60 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 121.12sec 0 300.90sec
Shaerlyn Shaerlyn fire_elemental_totem 2894 0 0 0.30 0 0 1.5 1.5 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Shaerlyn Shaerlyn flame_shock 8050 71160 236 2.14 4017 10021 10.7 10.7 15.0% 0.0% 0.0% 0.0% 29.18sec 495492 300.90sec
Shaerlyn Shaerlyn flame_shock ticks -8050 424331 1414 24.95 2049 5123 10.7 124.7 15.1% 0.0% 0.0% 0.0% 29.18sec 495492 300.90sec
Shaerlyn Shaerlyn lava_burst 51505 2929101 9734 12.05 0 33978 60.5 60.4 100.0% 0.0% 0.0% 0.0% 4.91sec 2929101 300.90sec
Shaerlyn Shaerlyn lightning_bolt 403 1914237 6362 19.07 12104 30251 95.9 95.6 15.2% 0.0% 0.0% 0.0% 2.91sec 1914237 300.90sec
Shaerlyn Shaerlyn lightning_shield 324 0 0 0.20 0 0 1.0 1.0 15.3% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Shaerlyn Shaerlyn molten_earth 170379 1209633 4020 24.91 5841 14605 125.4 124.9 15.1% 0.0% 0.0% 0.0% 2.38sec 1209633 300.90sec
Shaerlyn Shaerlyn searing_totem 3599 0 0 0.77 0 0 3.9 3.9 0.0% 0.0% 0.0% 0.0% 66.11sec 0 300.90sec
Shaerlyn Shaerlyn unleash_flame 165462 0 0 3.65 0 0 18.3 18.3 0.0% 0.0% 0.0% 0.0% 16.85sec 0 300.90sec
Shaerlyn Shaerlyn_greater_fire_elemental fire_blast 57984 15022 195 9.92 763 1909 12.7 12.7 15.2% 0.0% 0.0% 0.0% 15.59sec 15022 76.92sec
Shaerlyn Shaerlyn_greater_fire_elemental melee 0 194429 2528 57.23 1711 4276 73.4 73.4 15.2% 0.0% 0.0% 0.0% 2.56sec 194429 76.92sec
Shaerlyn Shaerlyn_searing_totem searing_bolt 3606 241274 1166 35.40 1280 3199 122.4 122.1 15.1% 0.0% 0.0% 0.0% 1.83sec 241274 206.88sec
Candylicious Candylicious chaos_bolt 116858 1569390 5216 4.91 0 59797 24.8 24.6 100.0% 0.0% 0.0% 0.0% 12.00sec 1569390 300.90sec
Candylicious Candylicious conflagrate 17962 546263 1815 5.26 14658 30155 26.4 26.4 30.9% 0.0% 0.0% 0.0% 11.57sec 546263 300.90sec
Candylicious Candylicious dark_soul 113858 0 0 0.60 0 0 3.0 3.0 22.7% 0.0% 0.0% 0.0% 120.97sec 0 300.90sec
Candylicious Candylicious draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Candylicious Candylicious immolate 348 202139 672 4.10 7089 14568 20.6 20.6 28.4% 0.0% 0.0% 0.0% 14.91sec 779698 300.90sec
Candylicious Candylicious immolate ticks -348 577559 1925 23.62 3522 7219 20.6 118.1 28.8% 0.0% 0.0% 0.0% 14.91sec 779698 300.90sec
Candylicious Candylicious incinerate 29722 1871463 6219 26.65 10240 20946 134.5 133.6 27.1% 0.0% 0.0% 0.0% 2.23sec 1871463 300.90sec
Candylicious Candylicious shattered_bleed 159238 35597 118 3.49 1554 3108 17.5 17.5 22.9% 0.0% 0.0% 0.0% 17.52sec 115945 300.90sec
Candylicious Candylicious shattered_bleed ticks -159238 80348 268 19.64 767 0 17.5 98.2 0.0% 0.0% 0.0% 0.0% 17.52sec 115945 300.90sec
Candylicious Candylicious summon_terrorguard 112927 0 0 0.40 0 0 1.0 2.0 20.6% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Candylicious Candylicious_terrorguard doom_bolt 85692 1741810 5789 20.47 12187 24938 103.3 102.7 29.3% 0.0% 0.0% 0.0% 2.90sec 1741810 300.90sec
Dârkride Dârkride auto_attack_mh 0 740269 2460 26.58 4466 9034 133.3 133.3 19.1% 0.0% 0.0% 0.0% 2.27sec 1137676 300.90sec
Dârkride Dârkride berserker_rage 18499 0 0 1.82 0 0 9.1 9.1 0.0% 0.0% 0.0% 0.0% 34.51sec 0 300.90sec
Dârkride Dârkride blood_craze 159362 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 16.23sec 137261 300.90sec
Dârkride Dârkride bloodbath ticks -113344 379068 1264 18.42 4115 0 5.5 92.1 0.0% 0.0% 0.0% 0.0% 60.04sec 379068 300.90sec
Dârkride Dârkride charge 100 0 0 0.20 0 0 1.0 1.0 16.7% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Dârkride Dârkride deep_wounds ticks -115767 590310 1968 19.73 4828 9736 120.8 98.7 18.8% 0.0% 0.0% 0.0% 2.47sec 590310 300.90sec
Dârkride Dârkride devastate 20243 1310966 4357 24.08 8731 17700 120.8 120.8 19.0% 0.0% 0.0% 0.0% 2.47sec 2014748 300.90sec
Dârkride Dârkride draenic_armor_potion 156430 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Dârkride Dârkride dragon_roar 118000 160569 534 1.07 0 28756 5.4 5.4 100.0% 0.0% 0.0% 0.0% 61.13sec 160569 300.90sec
Dârkride Dârkride execute 5308 206939 688 1.32 25398 50871 6.6 6.6 18.3% 0.0% 0.0% 0.0% 7.92sec 318032 300.90sec
Dârkride Dârkride heroic_leap 6544 23509 78 1.37 2729 5634 6.9 6.9 19.4% 0.0% 0.0% 0.0% 46.03sec 36130 300.90sec
Dârkride Dârkride heroic_strike 78 1216857 4044 37.30 4978 10189 187.0 187.0 24.5% 0.0% 0.0% 0.0% 1.61sec 1870117 300.90sec
Dârkride Dârkride revenge 6572 561808 1867 6.02 14999 30299 30.2 30.2 19.0% 0.0% 0.0% 0.0% 10.09sec 863410 300.90sec
Dârkride Dârkride shattered_bleed 159238 43577 145 3.38 2076 4159 16.9 16.9 19.0% 0.0% 0.0% 0.0% 18.21sec 123190 300.90sec
Dârkride Dârkride shattered_bleed ticks -159238 79614 265 19.21 796 0 16.9 96.1 0.0% 0.0% 0.0% 0.0% 18.21sec 123190 300.90sec
Dârkride Dârkride shield_charge 156321 0 0 4.24 0 0 21.3 21.3 0.0% 0.0% 0.0% 0.0% 14.53sec 0 300.90sec
Dârkride Dârkride shield_slam 23922 1367834 4546 13.33 16423 33400 66.9 66.9 19.1% 0.0% 0.0% 0.0% 4.52sec 2102146 300.90sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

DPS Taken Timeline Chart
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=374|1:|0|&chxp=1,1,-1,100

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.57% 10.57% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.57%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.37% 10.37% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.37%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.54% 10.54% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.03% 11.03% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.54% 10.54% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.58% 10.58% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.64% 11.64% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.64%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.34% 11.34% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.91% 7.91% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.91%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.48% 5.48% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.48%

Trigger Attempt Success

  • trigger_pct:100.00%
censure 1.0 299.3 0.0sec 1.0sec 99.56% 100.00% 295.3(295.3)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • censure_1:0.34%
  • censure_2:0.11%
  • censure_3:0.23%
  • censure_4:0.34%
  • censure_5:98.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
censure 1.0 294.9 0.0sec 1.0sec 99.55% 100.00% 290.9(290.9)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • censure_1:0.35%
  • censure_2:0.11%
  • censure_3:0.24%
  • censure_4:0.35%
  • censure_5:98.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
find_weakness 9.5 23.8 33.0sec 9.1sec 48.67% 48.67% 23.8(23.8)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • find_weakness_1:48.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:$w1% of armor is ignored by the attacking Rogue.
  • description:Your Ambush, Garrote, and Cheap Shot abilities reveal a flaw in your target's defenses, causing all your attacks to bypass a portion of that enemy's armor for {$91021d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
water_jet 10.0 0.0 30.4sec 30.4sec 11.33% 16.57% 0.0(0.0)

Buff details

  • buff initial source:Procrank_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • water_jet_1:11.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $s1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
water_jet 10.0 0.0 30.3sec 30.3sec 11.22% 16.72% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • water_jet_1:11.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $s1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 318579.13
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 35959
death count pct 143.81
avg death time 300.38
min death time 229.11
max death time 374.64
dmg taken 95871145.87

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 25000
Mean 300.90
Minimum 229.11
Maximum 374.64
Spread ( max - min ) 145.53
Range [ ( max - min ) / 2 * 100% ] 24.18%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 25000
Mean 319267.07
Minimum 303622.12
Maximum 334900.45
Spread ( max - min ) 31278.32
Range [ ( max - min ) / 2 * 100% ] 4.90%
Standard Deviation 5503.6152
5th Percentile 310359.21
95th Percentile 327351.03
( 95th Percentile - 5th Percentile ) 16991.82
Mean Distribution
Standard Deviation 34.8079
95.00% Confidence Intervall ( 319198.85 - 319335.29 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1141
0.1 Scale Factor Error with Delta=300 258570
0.05 Scale Factor Error with Delta=300 1034283
0.01 Scale Factor Error with Delta=300 25857098
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 6242
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 76532496 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Multistrike 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1938 1938 1938
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=103
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.